BP912131
Clone id YMU001_000015_E02
Library
Length 543
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000015_E02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CGAAGCCTTTGCTCATTATAATTTGAAACACCTACTGCCTTCACAAGGCCTTGCTCAACA
GCGTCAGCCAATCCGTCAATGTAACCTTCATTTCCCCACAGTCCAGGCCAATGAAGCTGA
TATAAATCAACAGAACTAAGATCAAGACGTTTTAGCGACTCCTTCAAGGCACAAATCAGA
CTTCCTCTACCCAATCGCCATGGCAGTGCGGCAAATTTCGTGGCTATGGCGATGCCCTTG
CTGTCAAGTCTGTTTCTCTCCTTCACAAACCTGCCCAGTAACCTTTCTGATTCTCCTCCA
ACGCCCATAATCTGAGATCCATACACCTCAGCTGTGTCGAAGAAATTAATACCCACATCC
ACGCTAGCATTGAAGGCAGCCCTGGCATCCTCTACGTTCCTATCGTTCCAAGACCCATTG
TTCCAGTAGAAAGTATCGCCCCACGACCATGCTCCAATACCAACCTTCGTGACCTCCACA
TCTGAAGCTCCGAGTCTTACCTTGTCAGCTGATGCTTGCAAAATTGCTGTTGAGGAATTG
CTG
■■Homology search results ■■ -
sp_hit_id Q94A68
Definition sp|Q94A68|Y1669_ARATH Uncharacterized oxidoreductase At1g06690, chloroplastic OS=Arabidopsis thaliana
Align length 181
Score (bit) 238.0
E-value 1.0e-62
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912131|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_E02.
(543 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q94A68|Y1669_ARATH Uncharacterized oxidoreductase At1g06690, ... 238 1e-62
sp|P80874|GS69_BACSU General stress protein 69 OS=Bacillus subti... 84 6e-16
sp|P77735|YAJO_ECOLI Uncharacterized oxidoreductase yajO OS=Esch... 68 3e-11
sp|P46905|YCCK_BACSU Uncharacterized oxidoreductase yccK OS=Baci... 67 6e-11
sp|P76234|YEAE_ECOLI Uncharacterized protein yeaE OS=Escherichia... 66 1e-10
sp|P46336|IOLS_BACSU Protein iolS OS=Bacillus subtilis GN=iolS P... 65 2e-10
sp|P63485|Y2320_MYCBO Uncharacterized oxidoreductase Mb2320 OS=M... 63 1e-09
sp|P63484|Y2298_MYCTU Uncharacterized oxidoreductase Rv2298/MT23... 63 1e-09
sp|P15339|DKGB_CORSS 2,5-diketo-D-gluconic acid reductase B OS=C... 62 1e-09
sp|P54569|YQKF_BACSU Uncharacterized oxidoreductase yqkF OS=Baci... 60 5e-09
sp|Q40648|KCAB_ORYSJ Probable voltage-gated potassium channel su... 60 9e-09
sp|P0A9T5|TAS_SHIFL Protein tas OS=Shigella flexneri GN=tas PE=3... 59 2e-08
sp|P0A9T4|TAS_ECOLI Protein tas OS=Escherichia coli (strain K12)... 59 2e-08
sp|Q8ZM06|DKGA_SALTY 2,5-diketo-D-gluconic acid reductase A OS=S... 56 1e-07
sp|P58744|DKGA_SALTI Putative 2,5-diketo-D-gluconic acid reducta... 56 1e-07
sp|Q8XBT6|DKGA_ECO57 2,5-diketo-D-gluconic acid reductase A OS=E... 56 1e-07
sp|Q9P7U2|YI7E_SCHPO Putative aryl-alcohol dehydrogenase C977.14... 55 2e-07
sp|O59826|KCAB_SCHPO Putative voltage-gated potassium channel su... 55 2e-07
sp|Q8ZRM7|DKGB_SALTY 2,5-diketo-D-gluconic acid reductase B OS=S... 55 3e-07
sp|Q8Z988|DKGB_SALTI 2,5-diketo-D-gluconic acid reductase B OS=S... 55 3e-07
sp|Q46851|YGHZ_ECOLI Uncharacterized protein yghZ OS=Escherichia... 54 6e-07
sp|Q8X529|YGHZ_ECO57 Uncharacterized protein yghZ OS=Escherichia... 54 6e-07
sp|Q14722|KCAB1_HUMAN Voltage-gated potassium channel subunit be... 54 6e-07
sp|Q9PTM5|KCAB2_XENLA Voltage-gated potassium channel subunit be... 53 8e-07
sp|Q13303|KCAB2_HUMAN Voltage-gated potassium channel subunit be... 53 8e-07
sp|Q27955|KCAB2_BOVIN Voltage-gated potassium channel subunit be... 53 8e-07
sp|Q46857|DKGA_ECOLI 2,5-diketo-D-gluconic acid reductase A OS=E... 53 8e-07
sp|P62483|KCAB2_RAT Voltage-gated potassium channel subunit beta... 53 1e-06
sp|P62482|KCAB2_MOUSE Voltage-gated potassium channel subunit be... 53 1e-06
sp|P63144|KCAB1_RAT Voltage-gated potassium channel subunit beta... 52 2e-06

>sp|Q94A68|Y1669_ARATH Uncharacterized oxidoreductase At1g06690,
chloroplastic OS=Arabidopsis thaliana GN=At1g06690 PE=1
SV=1
Length = 377

Score = 238 bits (607), Expect = 1e-62
Identities = 115/181 (63%), Positives = 141/181 (77%), Gaps = 1/181 (0%)
Frame = -2

Query: 542 SNSSTAILQASADKVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNAS 363
S S A + KV+LG SD++VTK+GIG WSWGD YWN+ W+DR ++ A+ AF+ S
Sbjct: 35 SGDSVAPAISEESKVKLGGSDLKVTKLGIGVWSWGDNSYWNDFQWDDRKLKAAKGAFDTS 94

Query: 362 VDVGINFFDTAEVYGSQIMGVGGESERLLGRFVKERN-RLDSKGIAIATKFAALPWRLGR 186
+D GI+FFDTAEVYGS+ SE LLGRF++ER R +++ATKFAALPWR GR
Sbjct: 95 LDNGIDFFDTAEVYGSKFSLGAISSETLLGRFIRERKERYPGAEVSVATKFAALPWRFGR 154

Query: 185 GSLICALKESLKRLDLSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNEQR 6
S++ ALK+SL RL+LSSVDLYQLHWPGLWGNEGY+DGL DAVEQGLVKAVGVSNY+E+R
Sbjct: 155 ESVVTALKDSLSRLELSSVDLYQLHWPGLWGNEGYLDGLGDAVEQGLVKAVGVSNYSEKR 214

Query: 5 L 3
L
Sbjct: 215 L 215


>sp|P80874|GS69_BACSU General stress protein 69 OS=Bacillus subtilis
GN=yhdN PE=1 SV=2
Length = 331

Score = 83.6 bits (205), Expect = 6e-16
Identities = 53/167 (31%), Positives = 91/167 (54%), Gaps = 8/167 (4%)
Frame = -2

Query: 479 VEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNASVDVGINFFDTAEVYGSQIMGV 300
+E +++G+G W+ G T + G+ ++E RAA +D GI DTA YG
Sbjct: 11 IEASRIGLGTWAIGGTMW--GGTDEKTSIETIRAA----LDQGITLIDTAPAYGF----- 59

Query: 299 GGESERLLGRFVKERNRLDSKGIAIATKFAALPWR-------LGRGSLICALKESLKRLD 141
G+SE ++G+ +KE + D + +ATK AL W+ R ++ ++ SLKRL
Sbjct: 60 -GQSEEIVGKAIKEYGKRDQ--VILATK-TALDWKNNQLFRHANRARIVEEVENSLKRLQ 115

Query: 140 LSSVDLYQLHWPG-LWGNEGYIDGLADAVEQGLVKAVGVSNYNEQRL 3
+DLYQ+HWP L E + + + + G ++A+GVSN++ +++
Sbjct: 116 TDYIDLYQVHWPDPLVPIEETAEVMKELYDAGKIRAIGVSNFSIEQM 162


>sp|P77735|YAJO_ECOLI Uncharacterized oxidoreductase yajO
OS=Escherichia coli (strain K12) GN=yajO PE=3 SV=2
Length = 324

Score = 68.2 bits (165), Expect = 3e-11
Identities = 48/163 (29%), Positives = 86/163 (52%), Gaps = 5/163 (3%)
Frame = -2

Query: 494 LGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNASVDVGINFFDTAEVYGS 315
LG +D+ V+++ +G ++G+ N+ +W E +R +++ GINFFDTA Y
Sbjct: 6 LGKTDLRVSRLCLGCMTFGEPDRGNH-AWTLPE-ESSRPIIKRALEGGINFFDTANSYSD 63

Query: 314 QIMGVGGESERLLGRFVKERNRLDSKGIAIATKF----AALPWRLGRGSLICALKESLKR 147
G SE ++GR +++ R + + +ATK LP L R ++ ++ +SL+R
Sbjct: 64 ------GSSEEIVGRALRDFARRED--VVVATKVFHRVGDLPEGLSRAQILRSIDDSLRR 115

Query: 146 LDLSSVDLYQLH-WPGLWGNEGYIDGLADAVEQGLVKAVGVSN 21
L + VD+ Q+H W E ++ L D V+ G + +G S+
Sbjct: 116 LGMDYVDILQIHRWDYNTPIEETLEALNDVVKAGKARYIGASS 158


>sp|P46905|YCCK_BACSU Uncharacterized oxidoreductase yccK
OS=Bacillus subtilis GN=yccK PE=3 SV=2
Length = 310

Score = 67.0 bits (162), Expect = 6e-11
Identities = 53/171 (30%), Positives = 87/171 (50%), Gaps = 7/171 (4%)
Frame = -2

Query: 494 LGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNASVDVGINFFDTAEVYGS 315
LG + ++V ++G GA + G + + + N E + ++D G+NF DTA +YG
Sbjct: 7 LGKTKLKVKRIGFGANAVG-----GHNLFPNLNDETGKDLVRTALDGGVNFIDTAFIYGL 61

Query: 314 QIMGVGGESERLLGRFVKERNRLDSKGIAIATKFA------ALPWRLGRGSLICALKESL 153
G SE L+G V+ER + + IATK A ++ R L +++SL
Sbjct: 62 ------GRSEELIGEVVQERGVRNE--LIIATKGAHKEVDGSIELDNSREFLRSEVEKSL 113

Query: 152 KRLDLSSVDLYQLHWPGLWGNEGYIDG-LADAVEQGLVKAVGVSNYNEQRL 3
KRL +DLY +H+P + G L + ++G +KA+G SN + Q+L
Sbjct: 114 KRLKTDYIDLYYVHFPDGKTPLAEVAGTLKELKDEGKIKAIGASNLDYQQL 164


>sp|P76234|YEAE_ECOLI Uncharacterized protein yeaE OS=Escherichia
coli (strain K12) GN=yeaE PE=4 SV=1
Length = 284

Score = 65.9 bits (159), Expect = 1e-10
Identities = 48/159 (30%), Positives = 74/159 (46%), Gaps = 3/159 (1%)
Frame = -2

Query: 488 ASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNASVDVGINFFDTAEVYGSQI 309
+ DV + VG G W G+ + R E A A A +++G+ DTAE+Y
Sbjct: 9 SGDVSLPAVGQGTWYMGEDA-------SQRKTEVA--ALRAGIELGLTLIDTAEMYAD-- 57

Query: 308 MGVGGESERLLGRFV---KERNRLDSKGIAIATKFAALPWRLGRGSLICALKESLKRLDL 138
G +E+++G + +E+ L SK PW G I A + SL+RL+
Sbjct: 58 ----GGAEKVVGEALTGLREKVFLVSK---------VYPWNAGGQKAINACEASLRRLNT 104

Query: 137 SSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSN 21
+DLY LHW G + E + + + QG ++ GVSN
Sbjct: 105 DYLDLYLLHWSGSFAFEETVAAMEKLIAQGKIRRWGVSN 143


>sp|P46336|IOLS_BACSU Protein iolS OS=Bacillus subtilis GN=iolS PE=1
SV=1
Length = 310

Score = 65.5 bits (158), Expect = 2e-10
Identities = 49/174 (28%), Positives = 88/174 (50%), Gaps = 7/174 (4%)
Frame = -2

Query: 503 KVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNASVDVGINFFDTAEV 324
K +LG SD++V +G+G + G + + + N E + ++ G+ DTA +
Sbjct: 3 KAKLGKSDLQVFPIGLGTNAVG-----GHNLYPNLNEETGKELVREAIRNGVTMLDTAYI 57

Query: 323 YGSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFAA------LPWRLGRGSLICALK 162
YG G SE L+G ++E NR D + IATK A + L ++
Sbjct: 58 YGI------GRSEELIGEVLREFNRED---VVIATKAAHRKQGNDFVFDNSPDFLKKSVD 108

Query: 161 ESLKRLDLSSVDLYQLHWPG-LWGNEGYIDGLADAVEQGLVKAVGVSNYNEQRL 3
ESLKRL+ +DL+ +H+P + ++ L + + G ++++GVSN++ ++L
Sbjct: 109 ESLKRLNTDYIDLFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQL 162


>sp|P63485|Y2320_MYCBO Uncharacterized oxidoreductase Mb2320
OS=Mycobacterium bovis GN=Mb2320 PE=3 SV=1
Length = 323

Score = 62.8 bits (151), Expect = 1e-09
Identities = 49/160 (30%), Positives = 81/160 (50%), Gaps = 3/160 (1%)
Frame = -2

Query: 476 EVTKVGIGAWSWGDTFYWNNGSWNDRNVEDA-RAAFNASVDVGINFFDTAEVYGSQIMGV 300
+V+++G+G W +G W G DR A R + +G+ FDTAE+YG
Sbjct: 11 QVSRIGLGTWQFGSR-EWGYG---DRYATGAARDIVKRARALGVTLFDTAEIYGL----- 61

Query: 299 GGESERLLGRFVKERNRLDSKGIAIATK-FAALPWRLGRGSLICALKESLKRLDLSSVDL 123
G+SER+LG + + D + +A+K F P+ + + S +RL L+ + L
Sbjct: 62 -GKSERILGEALGD----DRTEVVVASKVFPVAPF---PAVIKNRERASARRLQLNRIPL 113

Query: 122 YQLHWPG-LWGNEGYIDGLADAVEQGLVKAVGVSNYNEQR 6
YQ+H P + + + G+ D ++ G + A GVSNY+ R
Sbjct: 114 YQIHQPNPVVPDSVIMPGMRDLLDSGDIGAAGVSNYSLAR 153


>sp|P63484|Y2298_MYCTU Uncharacterized oxidoreductase Rv2298/MT2355
OS=Mycobacterium tuberculosis GN=Rv2298 PE=3 SV=1
Length = 323

Score = 62.8 bits (151), Expect = 1e-09
Identities = 49/160 (30%), Positives = 81/160 (50%), Gaps = 3/160 (1%)
Frame = -2

Query: 476 EVTKVGIGAWSWGDTFYWNNGSWNDRNVEDA-RAAFNASVDVGINFFDTAEVYGSQIMGV 300
+V+++G+G W +G W G DR A R + +G+ FDTAE+YG
Sbjct: 11 QVSRIGLGTWQFGSR-EWGYG---DRYATGAARDIVKRARALGVTLFDTAEIYGL----- 61

Query: 299 GGESERLLGRFVKERNRLDSKGIAIATK-FAALPWRLGRGSLICALKESLKRLDLSSVDL 123
G+SER+LG + + D + +A+K F P+ + + S +RL L+ + L
Sbjct: 62 -GKSERILGEALGD----DRTEVVVASKVFPVAPF---PAVIKNRERASARRLQLNRIPL 113

Query: 122 YQLHWPG-LWGNEGYIDGLADAVEQGLVKAVGVSNYNEQR 6
YQ+H P + + + G+ D ++ G + A GVSNY+ R
Sbjct: 114 YQIHQPNPVVPDSVIMPGMRDLLDSGDIGAAGVSNYSLAR 153


>sp|P15339|DKGB_CORSS 2,5-diketo-D-gluconic acid reductase B
OS=Corynebacterium sp. (strain SHS752001) GN=dkgB PE=1
SV=3
Length = 277

Score = 62.4 bits (150), Expect = 1e-09
Identities = 50/143 (34%), Positives = 75/143 (52%), Gaps = 5/143 (3%)
Frame = -2

Query: 416 GSWNDRNVEDARAAFNASVDVGINFFDTAEVYGSQIMGVGGESERLLGRFVKERNRLDSK 237
G++N R E AA A++D G DTA Y E+E +GR V+ + +D
Sbjct: 21 GTYNLRGDEGV-AAMVAAIDSGYRLLDTAVNY---------ENESEVGRAVRASS-VDRD 69

Query: 236 GIAIATKFAALPWRL-GRGSLICALKESLKRLDLSSVDLYQLHWP----GLWGNEGYIDG 72
+ +A+K +P R GR + +++ SL RL L +DL +HWP G W + G
Sbjct: 70 ELIVASK---IPGRQHGRAEAVDSIRGSLDRLGLDVIDLQLIHWPNPSVGRWLDTW--RG 124

Query: 71 LADAVEQGLVKAVGVSNYNEQRL 3
+ DA E GLV+++GVSN+ E L
Sbjct: 125 MIDAREAGLVRSIGVSNFTEPML 147


>sp|P54569|YQKF_BACSU Uncharacterized oxidoreductase yqkF
OS=Bacillus subtilis GN=yqkF PE=3 SV=1
Length = 306

Score = 60.5 bits (145), Expect = 5e-09
Identities = 45/170 (26%), Positives = 85/170 (50%), Gaps = 9/170 (5%)
Frame = -2

Query: 503 KVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNASVDVGINFFDTAEV 324
K +LG SD+++++VG+G S G ++N A + + ++++GIN+ DTA++
Sbjct: 3 KRKLGTSDLDISEVGLGCMSLG----------TEKN--KALSILDEAIELGINYLDTADL 50

Query: 323 YGSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFA--------ALPWRLGRGSLICA 168
Y G +E ++G ++ R I +ATK W + + A
Sbjct: 51 YDR------GRNEEIVGDAIQNRRH----DIILATKAGNRWDDGSEGWYWDPSKAYIKEA 100

Query: 167 LKESLKRLDLSSVDLYQLHWPGLWGN-EGYIDGLADAVEQGLVKAVGVSN 21
+K+SL RL +DLYQLH + N + I+ + ++G+++ G+S+
Sbjct: 101 VKKSLTRLKTDYIDLYQLHGGTIEDNIDETIEAFEELKQEGVIRYYGISS 150


tr_hit_id A9NMW9
Definition tr|A9NMW9|A9NMW9_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 166
Score (bit) 256.0
E-value 4.0e-67
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912131|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_E02.
(543 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NMW9|A9NMW9_PICSI Putative uncharacterized protein OS=Picea... 256 4e-67
tr|Q8GSK5|Q8GSK5_ORYSJ Aldo/keto reductase family-like protein O... 248 1e-64
tr|Q0D8N4|Q0D8N4_ORYSJ Os07g0143000 protein OS=Oryza sativa subs... 248 1e-64
tr|B8B764|B8B764_ORYSI Putative uncharacterized protein OS=Oryza... 248 1e-64
tr|B6TB75|B6TB75_MAIZE Aldo-keto reductase/ oxidoreductase OS=Ze... 248 2e-64
tr|B4F9M8|B4F9M8_MAIZE Putative uncharacterized protein OS=Zea m... 248 2e-64
tr|Q8H4J8|Q8H4J8_ORYSJ Os07g0142900 protein OS=Oryza sativa subs... 247 3e-64
tr|A2YI35|A2YI35_ORYSI Putative uncharacterized protein OS=Oryza... 247 3e-64
tr|B6TYB4|B6TYB4_MAIZE Aldo-keto reductase yakc OS=Zea mays PE=2... 241 2e-62
tr|A7PJR4|A7PJR4_VITVI Chromosome chr12 scaffold_18, whole genom... 241 2e-62
tr|B8A0V5|B8A0V5_MAIZE Putative uncharacterized protein OS=Zea m... 241 2e-62
tr|A6N1S8|A6N1S8_ORYSI Aldo-keto reductase/oxidoreductase (Fragm... 200 5e-50
tr|B4FA37|B4FA37_MAIZE Putative uncharacterized protein OS=Zea m... 179 1e-43
tr|B8CCF3|B8CCF3_THAPS Predicted protein (Fragment) OS=Thalassio... 143 5e-33
tr|Q119A8|Q119A8_TRIEI Aldo/keto reductase OS=Trichodesmium eryt... 141 2e-32
tr|B0CFL4|B0CFL4_ACAM1 Oxidoreductase, aldo reductase OS=Acaryoc... 137 3e-31
tr|Q8YXI8|Q8YXI8_ANASP All1225 protein OS=Anabaena sp. (strain P... 137 4e-31
tr|Q3MFG8|Q3MFG8_ANAVT Aldo/keto reductase OS=Anabaena variabili... 135 1e-30
tr|A8YJ74|A8YJ74_MICAE Similar to Q3MFG8_ANAVT Aldo/keto reducta... 135 1e-30
tr|B4WKW2|B4WKW2_9SYNE Oxidoreductase, aldo/keto reductase famil... 135 2e-30
tr|A0YUI7|A0YUI7_9CYAN Aldo/keto reductase OS=Lyngbya sp. PCC 81... 134 3e-30
tr|B0JV94|B0JV94_MICAN Aldo/keto reductase OS=Microcystis aerugi... 132 9e-30
tr|Q55493|Q55493_SYNY3 Auxin-induced protein OS=Synechocystis sp... 132 1e-29
tr|A9TQS4|A9TQS4_PHYPA Predicted protein OS=Physcomitrella paten... 132 2e-29
tr|A0ZD71|A0ZD71_NODSP Putative uncharacterized protein OS=Nodul... 131 2e-29
tr|B7KLB4|B7KLB4_9CHRO Aldo/keto reductase OS=Cyanothece sp. PCC... 131 3e-29
tr|B4VJF1|B4VJF1_9CYAN Oxidoreductase, aldo/keto reductase famil... 130 6e-29
tr|Q3M8L6|Q3M8L6_ANAVT Aldo/keto reductase OS=Anabaena variabili... 127 4e-28
tr|A9S3D4|A9S3D4_PHYPA Predicted protein OS=Physcomitrella paten... 127 4e-28
tr|A8JFJ4|A8JFJ4_CHLRE Predicted protein (Fragment) OS=Chlamydom... 127 4e-28

>tr|A9NMW9|A9NMW9_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 375

Score = 256 bits (655), Expect = 4e-67
Identities = 121/166 (72%), Positives = 142/166 (85%)
Frame = -2

Query: 500 VRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNASVDVGINFFDTAEVY 321
++LGAS++EVTK+GIGAWSWGDT +WN+ SW+DR ++ A AAFNASVD GI FDTAEVY
Sbjct: 48 IKLGASELEVTKLGIGAWSWGDTTFWNDFSWDDRKMKAANAAFNASVDAGITLFDTAEVY 107

Query: 320 GSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFAALPWRLGRGSLICALKESLKRLD 141
GS++ SE LLGRF+KER + DS I +ATKFAALPWRLGRGS++ ALK+SL RL
Sbjct: 108 GSKLSFGAENSESLLGRFIKERKQRDSTEIVVATKFAALPWRLGRGSVVSALKDSLNRLG 167

Query: 140 LSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNEQRL 3
LSSVD+YQLHWPG+WGNEGYIDGL DAVE+GLVKAVGVSNYNEQRL
Sbjct: 168 LSSVDVYQLHWPGVWGNEGYIDGLGDAVEKGLVKAVGVSNYNEQRL 213


>tr|Q8GSK5|Q8GSK5_ORYSJ Aldo/keto reductase family-like protein
OS=Oryza sativa subsp. japonica GN=OJ1343_B12.101 PE=4
SV=1
Length = 376

Score = 248 bits (634), Expect = 1e-64
Identities = 123/183 (67%), Positives = 147/183 (80%), Gaps = 3/183 (1%)
Frame = -2

Query: 542 SNSSTAILQASAD---KVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAF 372
+++S A A+ + KVRLG SDV VTK+GIGAWSWGDT YWN W+DR ++ A+ AF
Sbjct: 33 ASASAAAAAAAVEEDGKVRLGGSDVAVTKLGIGAWSWGDTTYWNEFQWDDRKLKAAKGAF 92

Query: 371 NASVDVGINFFDTAEVYGSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFAALPWRL 192
+ASVD GI FFDTAEVYG+ I G SE LLGRF+KER + + +AIATKFAALPWRL
Sbjct: 93 DASVDCGITFFDTAEVYGAGISGAIN-SESLLGRFIKERQQKEQVEVAIATKFAALPWRL 151

Query: 191 GRGSLICALKESLKRLDLSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNE 12
GRGS+I ALK+SL RL +SSV+LYQLHWPG+WGNEGY+DGL DA EQGLVKAVGVSNY+E
Sbjct: 152 GRGSVISALKDSLSRLGVSSVELYQLHWPGIWGNEGYLDGLGDAYEQGLVKAVGVSNYSE 211

Query: 11 QRL 3
+RL
Sbjct: 212 KRL 214


>tr|Q0D8N4|Q0D8N4_ORYSJ Os07g0143000 protein OS=Oryza sativa subsp.
japonica GN=Os07g0143000 PE=2 SV=1
Length = 377

Score = 248 bits (634), Expect = 1e-64
Identities = 123/183 (67%), Positives = 147/183 (80%), Gaps = 3/183 (1%)
Frame = -2

Query: 542 SNSSTAILQASAD---KVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAF 372
+++S A A+ + KVRLG SDV VTK+GIGAWSWGDT YWN W+DR ++ A+ AF
Sbjct: 34 ASASAAAAAAAVEEDGKVRLGGSDVAVTKLGIGAWSWGDTTYWNEFQWDDRKLKAAKGAF 93

Query: 371 NASVDVGINFFDTAEVYGSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFAALPWRL 192
+ASVD GI FFDTAEVYG+ I G SE LLGRF+KER + + +AIATKFAALPWRL
Sbjct: 94 DASVDCGITFFDTAEVYGAGISGAIN-SESLLGRFIKERQQKEQVEVAIATKFAALPWRL 152

Query: 191 GRGSLICALKESLKRLDLSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNE 12
GRGS+I ALK+SL RL +SSV+LYQLHWPG+WGNEGY+DGL DA EQGLVKAVGVSNY+E
Sbjct: 153 GRGSVISALKDSLSRLGVSSVELYQLHWPGIWGNEGYLDGLGDAYEQGLVKAVGVSNYSE 212

Query: 11 QRL 3
+RL
Sbjct: 213 KRL 215


>tr|B8B764|B8B764_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_24866 PE=4 SV=1
Length = 384

Score = 248 bits (634), Expect = 1e-64
Identities = 123/183 (67%), Positives = 147/183 (80%), Gaps = 3/183 (1%)
Frame = -2

Query: 542 SNSSTAILQASAD---KVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAF 372
+++S A A+ + KVRLG SDV VTK+GIGAWSWGDT YWN W+DR ++ A+ AF
Sbjct: 33 ASASAAAAAAAVEEDGKVRLGGSDVAVTKLGIGAWSWGDTTYWNEFQWDDRKLKAAKGAF 92

Query: 371 NASVDVGINFFDTAEVYGSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFAALPWRL 192
+ASVD GI FFDTAEVYG+ I G SE LLGRF+KER + + +AIATKFAALPWRL
Sbjct: 93 DASVDCGITFFDTAEVYGAGISGAIN-SESLLGRFIKERQQKEQVEVAIATKFAALPWRL 151

Query: 191 GRGSLICALKESLKRLDLSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNE 12
GRGS+I ALK+SL RL +SSV+LYQLHWPG+WGNEGY+DGL DA EQGLVKAVGVSNY+E
Sbjct: 152 GRGSVISALKDSLSRLGVSSVELYQLHWPGIWGNEGYLDGLGDAYEQGLVKAVGVSNYSE 211

Query: 11 QRL 3
+RL
Sbjct: 212 KRL 214


>tr|B6TB75|B6TB75_MAIZE Aldo-keto reductase/ oxidoreductase OS=Zea
mays PE=2 SV=1
Length = 378

Score = 248 bits (632), Expect = 2e-64
Identities = 117/180 (65%), Positives = 145/180 (80%)
Frame = -2

Query: 542 SNSSTAILQASADKVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNAS 363
S +T +++ KVRLG S V VTK+GIGAWSWGDT YWN+ W+DR + +A+ AF+AS
Sbjct: 39 SAGATRVVEEDEGKVRLGGSGVAVTKLGIGAWSWGDTTYWNDSEWDDRRLREAQDAFDAS 98

Query: 362 VDVGINFFDTAEVYGSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFAALPWRLGRG 183
+D G+ FFDTAEVYG+ +MG SE LLG F+KER + + +A+ATKFAALPWR GRG
Sbjct: 99 IDNGMTFFDTAEVYGTALMGAVN-SETLLGGFIKERQQKEQIEVAVATKFAALPWRFGRG 157

Query: 182 SLICALKESLKRLDLSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNEQRL 3
S++ ALK+SL RL L+SV+LYQLHWPG+WGNEGY+DGLADA EQGLVKAVGVSNYNE+RL
Sbjct: 158 SVLSALKKSLDRLGLASVELYQLHWPGIWGNEGYLDGLADAYEQGLVKAVGVSNYNEKRL 217


>tr|B4F9M8|B4F9M8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 374

Score = 248 bits (632), Expect = 2e-64
Identities = 116/179 (64%), Positives = 145/179 (81%)
Frame = -2

Query: 539 NSSTAILQASADKVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNASV 360
+ +T +++ KVRLG S V VTK+GIGAWSWGDT YWN+ W+DR + +A+ AF+AS+
Sbjct: 36 SGATRVVEEDEGKVRLGGSGVAVTKLGIGAWSWGDTTYWNDSEWDDRRLREAQDAFDASI 95

Query: 359 DVGINFFDTAEVYGSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFAALPWRLGRGS 180
D G+ FFDTAEVYG+ +MG SE LLG F+KER + D +++ATKFAALPWR GRGS
Sbjct: 96 DNGMTFFDTAEVYGTALMGAVN-SETLLGGFIKERQQKDQIEVSVATKFAALPWRFGRGS 154

Query: 179 LICALKESLKRLDLSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNEQRL 3
++ ALK+SL RL L+SV+LYQLHWPG+WGNEGY+DGLADA EQGLVKAVGVSNYNE+RL
Sbjct: 155 VLSALKKSLDRLGLASVELYQLHWPGIWGNEGYLDGLADAYEQGLVKAVGVSNYNEKRL 213


>tr|Q8H4J8|Q8H4J8_ORYSJ Os07g0142900 protein OS=Oryza sativa subsp.
japonica GN=OJ1351_C05.128 PE=4 SV=2
Length = 376

Score = 247 bits (631), Expect = 3e-64
Identities = 117/180 (65%), Positives = 145/180 (80%)
Frame = -2

Query: 542 SNSSTAILQASADKVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNAS 363
S+++ A + KVRLG S+V V+K+GIGAWSWGDT YWN+ W+DR +++A+AAF+ S
Sbjct: 37 SDAAAAKVSEEEGKVRLGGSEVAVSKLGIGAWSWGDTTYWNDSEWDDRRLQEAKAAFDTS 96

Query: 362 VDVGINFFDTAEVYGSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFAALPWRLGRG 183
+D G+ FDTAEVYG+ +MG SE LLG F+KER + +A+ATKFAALPWR GRG
Sbjct: 97 IDNGMTLFDTAEVYGTALMGAVN-SESLLGGFIKERQEKEQIDVAVATKFAALPWRFGRG 155

Query: 182 SLICALKESLKRLDLSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNEQRL 3
S++ ALK+SL RL LSSV+LYQLHWPGLWGNEGY+DGLADA EQGLVKAVGVSNYNE+RL
Sbjct: 156 SVLSALKKSLDRLGLSSVELYQLHWPGLWGNEGYLDGLADAYEQGLVKAVGVSNYNEKRL 215


>tr|A2YI35|A2YI35_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_24865 PE=4 SV=1
Length = 376

Score = 247 bits (631), Expect = 3e-64
Identities = 117/180 (65%), Positives = 145/180 (80%)
Frame = -2

Query: 542 SNSSTAILQASADKVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNAS 363
S+++ A + KVRLG S+V V+K+GIGAWSWGDT YWN+ W+DR +++A+AAF+ S
Sbjct: 37 SDAAAAKVSEEEGKVRLGGSEVAVSKLGIGAWSWGDTTYWNDSEWDDRRLQEAKAAFDTS 96

Query: 362 VDVGINFFDTAEVYGSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFAALPWRLGRG 183
+D G+ FDTAEVYG+ +MG SE LLG F+KER + +A+ATKFAALPWR GRG
Sbjct: 97 IDNGMTLFDTAEVYGTALMGAVN-SESLLGGFIKERQEKEQIDVAVATKFAALPWRFGRG 155

Query: 182 SLICALKESLKRLDLSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNEQRL 3
S++ ALK+SL RL LSSV+LYQLHWPGLWGNEGY+DGLADA EQGLVKAVGVSNYNE+RL
Sbjct: 156 SVLSALKKSLDRLGLSSVELYQLHWPGLWGNEGYLDGLADAYEQGLVKAVGVSNYNEKRL 215


>tr|B6TYB4|B6TYB4_MAIZE Aldo-keto reductase yakc OS=Zea mays PE=2
SV=1
Length = 375

Score = 241 bits (615), Expect = 2e-62
Identities = 114/167 (68%), Positives = 135/167 (80%)
Frame = -2

Query: 503 KVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNASVDVGINFFDTAEV 324
KV LG S V VTK+G+GAWSWGDT YWN W+D ++ A+ AF+AS+D GI FFDTAEV
Sbjct: 48 KVALGGSGVSVTKLGVGAWSWGDTTYWNEFRWDDTKLKAAKGAFDASIDCGITFFDTAEV 107

Query: 323 YGSQIMGVGGESERLLGRFVKERNRLDSKGIAIATKFAALPWRLGRGSLICALKESLKRL 144
YG+ + G SE LLGRF+KER R + +A+ATKFAALPWR GRGS+ICALK SL RL
Sbjct: 108 YGAGVSGAIN-SESLLGRFIKERQRKEQVDVAVATKFAALPWRFGRGSVICALKASLDRL 166

Query: 143 DLSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNEQRL 3
+SSV+LYQLHWPG+WGNE Y+DGL DAVEQGLVKAVGVSNY+E+RL
Sbjct: 167 GVSSVELYQLHWPGIWGNEDYLDGLGDAVEQGLVKAVGVSNYSEKRL 213


>tr|A7PJR4|A7PJR4_VITVI Chromosome chr12 scaffold_18, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00018845001
PE=4 SV=1
Length = 367

Score = 241 bits (615), Expect = 2e-62
Identities = 117/176 (66%), Positives = 141/176 (80%), Gaps = 1/176 (0%)
Frame = -2

Query: 527 AILQASADKVRLGASDVEVTKVGIGAWSWGDTFYWNNGSWNDRNVEDARAAFNASVDVGI 348
A ++ +KV+LG SD++VTK+GIGAWSWGDT YWNN W+DR ++ A+ AF+AS+DVGI
Sbjct: 30 ATVKTEEEKVKLGGSDLKVTKLGIGAWSWGDTSYWNNFEWDDRKMKAAKGAFDASIDVGI 89

Query: 347 NFFDTAEVYGSQIMGVGGESERLLGRFVKERNRLDSK-GIAIATKFAALPWRLGRGSLIC 171
FDTAEVYGS+ SE LLGRF+KER + + +A+ATKFAALPWR GR S+I
Sbjct: 90 TLFDTAEVYGSRFSFGAINSETLLGRFIKERKEKNPEVEVAVATKFAALPWRFGRQSVIT 149

Query: 170 ALKESLKRLDLSSVDLYQLHWPGLWGNEGYIDGLADAVEQGLVKAVGVSNYNEQRL 3
ALK+SL RL L SVDLYQLHWPG+WGNEGYIDGL DAVE GLVKAVGVSNY+E+RL
Sbjct: 150 ALKDSLCRLGLLSVDLYQLHWPGVWGNEGYIDGLGDAVEMGLVKAVGVSNYSEKRL 205