BP912136
Clone id YMU001_000015_E07
Library
Length 518
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000015_E07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTTTCACAACACTTGTCATCGCAACAAAGCTGTATTGAGTACTCGACAATTTTTGTCCAT
TGAAATTGTTCCTGATACGGTGTGCTCCAAATGTTCTAATAAACGGATGCGACCAGCACA
TAGGGACTTCGTCGCGACACATCATTAAGAATTAGGTGCCAGTGGTAGTCCCAGAGACTC
ATATTCACCACATGTGGAATATGTCTCAAATAAGGATGGCCGAAAAAGCGGCATCCATCA
AGTACAAGATGTACTTATGTGTGGAGGAACTGCAAAACACTCCGCGACAAGAGTGAGAGG
GACCCTCATTATCTTGCTCCACACTGGCTAAACCGAACTCCTTGAGTTCCTACACCATGT
CGTATCCCATGTGACAACATGTGCCAAATTGAACCCTACAAGTAGGTTCGTAACAACATA
AGACAGAAAGATAGATTGGACACTTGGCCCAAAATACTTTGTGCCGACATGCCCTTGGCA
TGGCTCTGTAACATTCAAGCGTACTTAGACGTCTTGAA
■■Homology search results ■■ -
sp_hit_id Q2KV10
Definition sp|Q2KV10|ANMK_BORA1 Anhydro-N-acetylmuramic acid kinase OS=Bordetella avium (strain 197N)
Align length 51
Score (bit) 31.2
E-value 3.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912136|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_E07.
(518 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2KV10|ANMK_BORA1 Anhydro-N-acetylmuramic acid kinase OS=Bord... 31 3.0
sp|P08346|VE3_BPV4 Probable protein E3 OS=Bovine papillomavirus ... 31 4.0
sp|P07526|NXL3_OPHHA Long neurotoxin 3 OS=Ophiophagus hannah PE=... 30 5.2
sp|Q5AXV1|MCH1_EMENI Probable transporter mch1 OS=Emericella nid... 30 6.8
sp|P31821|GAG_FIVT2 Gag polyprotein OS=Feline immunodeficiency v... 30 8.8

>sp|Q2KV10|ANMK_BORA1 Anhydro-N-acetylmuramic acid kinase
OS=Bordetella avium (strain 197N) GN=anmK PE=3 SV=1
Length = 372

Score = 31.2 bits (69), Expect = 3.0
Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 3/51 (5%)
Frame = +2

Query: 143 H*ELGASG---SPRDSYSPHVEYVSNKDGRKSGIHQVQDVLMCGGTAKHSA 286
H L +SG SP+D + VE + R +QD+L+CGG A++ A
Sbjct: 257 HKHLDSSGLRLSPQDVQATLVELTAQTVARAIASEPIQDLLVCGGGARNPA 307


>sp|P08346|VE3_BPV4 Probable protein E3 OS=Bovine papillomavirus
type 4 GN=E3 PE=4 SV=1
Length = 98

Score = 30.8 bits (68), Expect = 4.0
Identities = 12/28 (42%), Positives = 16/28 (57%)
Frame = +1

Query: 193 CGICLK*GWPKKRHPSSTRCTYVWRNCK 276
C CL + KR +RCTYVW+ C+
Sbjct: 56 CTQCLPPEYQNKRLRMQSRCTYVWKACR 83


>sp|P07526|NXL3_OPHHA Long neurotoxin 3 OS=Ophiophagus hannah PE=1
SV=1
Length = 73

Score = 30.4 bits (67), Expect = 5.2
Identities = 17/51 (33%), Positives = 21/51 (41%)
Frame = -3

Query: 396 GFNLAHVVTWDTTWCRNSRSSV*PVWSKIMRVPLTLVAECFAVPPHISTSC 244
G +L + TW WC + RV LT A C VPP +S C
Sbjct: 17 GQDLCYTETWCVAWCT----------VRGKRVSLTCAAICPIVPPKVSIKC 57


>sp|Q5AXV1|MCH1_EMENI Probable transporter mch1 OS=Emericella
nidulans GN=mch1 PE=3 SV=2
Length = 615

Score = 30.0 bits (66), Expect = 6.8
Identities = 21/74 (28%), Positives = 32/74 (43%), Gaps = 4/74 (5%)
Frame = -2

Query: 448 AKCPIYLSVLCCYEPTCRVQFGTCCHMGYDMV*ELKEFGLASVEQDNEGPSHSCRGVFCS 269
A C +YL+ + TC FG H G + + FGL+ + Q G C + S
Sbjct: 195 ATCSMYLAAVT----TCAKNFGRGKHKGIILAVPIAAFGLSGMWQSQVGTYFLCERLKDS 250

Query: 268 S----STHKYILYL 239
+ +KY L+L
Sbjct: 251 NCGDVDVYKYFLFL 264


>sp|P31821|GAG_FIVT2 Gag polyprotein OS=Feline immunodeficiency
virus (isolate TM2) GN=gag PE=3 SV=1
Length = 449

Score = 29.6 bits (65), Expect = 8.8
Identities = 15/47 (31%), Positives = 22/47 (46%)
Frame = +3

Query: 207 QIRMAEKAASIKYKMYLCVEELQNTPRQE*EGPSLSCSTLAKPNSLS 347
++R ++ S YKM L E L + +GP L C KP L+
Sbjct: 341 KLRACQEVGSPGYKMQLLAEALTRVQTVQTKGPRLVCFNCKKPGHLA 387


tr_hit_id B0P1F5
Definition tr|B0P1F5|B0P1F5_9CLOT Putative uncharacterized protein OS=Clostridium sp. SS2/1
Align length 41
Score (bit) 33.9
E-value 5.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912136|Adiantum capillus-veneris mRNA, clone:
YMU001_000015_E07.
(518 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B0P1F5|B0P1F5_9CLOT Putative uncharacterized protein OS=Clost... 34 5.0
tr|A4T8I2|A4T8I2_MYCGI Putative uncharacterized protein OS=Mycob... 33 8.5

>tr|B0P1F5|B0P1F5_9CLOT Putative uncharacterized protein
OS=Clostridium sp. SS2/1 GN=CLOSS21_01542 PE=4 SV=1
Length = 102

Score = 33.9 bits (76), Expect = 5.0
Identities = 16/41 (39%), Positives = 25/41 (60%)
Frame = +2

Query: 20 RNKAVLSTRQFLSIEIVPDTVCSKCSNKRMRPAHRDFVATH 142
R K V S +QFL I +PD +C +NK++ ++ D V+ H
Sbjct: 47 RTKFVFSRKQFLGIRPIPDVICG--TNKKLIDSNFDVVSDH 85


>tr|A4T8I2|A4T8I2_MYCGI Putative uncharacterized protein
OS=Mycobacterium gilvum (strain PYR-GCK) GN=Mflv_2341
PE=4 SV=1
Length = 124

Score = 33.1 bits (74), Expect = 8.5
Identities = 19/62 (30%), Positives = 30/62 (48%), Gaps = 1/62 (1%)
Frame = -3

Query: 483 PCQGHVGTKYFGPSVQSIFLSYVVTNLLVGFNLAHVVTWD-TTWCRNSRSSV*PVWSKIM 307
P Q +G K FGP +F+++++ L+VG V WD W S+ P+ S I
Sbjct: 39 PPQTEIGVKIFGPIHGGVFVAFLIAALMVGV----AVKWDVAAWLLALLGSIVPLGSVIF 94

Query: 306 RV 301
+
Sbjct: 95 LI 96