BP912194
Clone id YMU001_000016_C02
Library
Length 576
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000016_C02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGCCCAATACTTTGTCTGCGCTCCAATCGAAGTCGCTATTTTTAACGCGTCCAACGATG
ATGCATTACATTGGAACACGAGATGAACTGTTGGCAACTGCTGGGGAGGTTTTTACCAAT
GTGGCCTCTGGGATACTGAAGGCTCGGGTGAACCACACATATCCGCTGTCTCAAGCTGCT
GAAGCCCATTGTGATTTGGAATCAAGGAAAACCTCTGGATGTATCATTTTGCTCCCAGGA
TCTGCAGAGTGAAGCTCAGCTAGTGTGTTTAGCCTTGGTAAGGGTCACATTTAGCAATCT
TGAGTTCATAAGAATAAAAGGCTCACATTATGTGAGTTTCAATAAGGGAGTTATGACTGA
AATTTGTGAGTCATTTTGAACATTGTCCTTAATGAAAATAAAAGGAAGTGGAGGAGAACA
AAATCTCATAGTCACAAGGGAACGCGTTCCCTAGAGGGAGCCGCTCTTGTTCCCGCCTCT
TAATGACTTGAGAGATTGTGTAAGCATTATATGTGAACTAGGTTCATGTGAGACAAATAT
ATGCAACTACTGTTAGTTTCAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id P28304
Definition sp|P28304|QOR_ECOLI Quinone oxidoreductase OS=Escherichia coli (strain K12)
Align length 73
Score (bit) 63.5
E-value 7.0e-10
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912194|Adiantum capillus-veneris mRNA, clone:
YMU001_000016_C02.
(560 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P28304|QOR_ECOLI Quinone oxidoreductase OS=Escherichia coli (... 64 7e-10
sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella typhimu... 62 2e-09
sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas aerugi... 60 6e-09
sp|P38230|QOR_YEAST Probable quinone oxidoreductase OS=Saccharom... 47 6e-05
sp|O74489|QOR_SCHPO Probable quinone oxidoreductase OS=Schizosac... 42 0.003
sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ P... 34 0.43
sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cr... 33 0.73
sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus GN... 32 1.6
sp|Q6GM65|PLAP_XENLA Phospholipase A-2-activating protein OS=Xen... 32 2.1
sp|Q9M1Y1|FBK76_ARATH F-box/Kelch-repeat protein At3g59940 OS=Ar... 31 4.7
sp|Q9YH32|ESR2_ORENI Estrogen receptor beta OS=Oreochromis nilot... 31 4.7
sp|P97929|BRCA2_MOUSE Breast cancer type 2 susceptibility protei... 30 8.1

>sp|P28304|QOR_ECOLI Quinone oxidoreductase OS=Escherichia coli
(strain K12) GN=qor PE=1 SV=1
Length = 327

Score = 63.5 bits (153), Expect = 7e-10
Identities = 33/73 (45%), Positives = 46/73 (63%), Gaps = 2/73 (2%)
Frame = +1

Query: 25 QSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARV--NHTYPLSQAAEAHCDL 198
Q SL++TRP++ YI TR+EL + E+F+ +ASG++K V YPL A AH L
Sbjct: 255 QKGSLYVTRPSLQGYITTREELTEASNELFSLIASGVIKVDVAEQQKYPLKDAQRAHEIL 314

Query: 199 ESRKTSGCIILLP 237
ESR T G +L+P
Sbjct: 315 ESRATQGSSLLIP 327


>sp|P40783|QOR_SALTY Quinone oxidoreductase OS=Salmonella
typhimurium GN=qor PE=3 SV=2
Length = 327

Score = 62.0 bits (149), Expect = 2e-09
Identities = 33/73 (45%), Positives = 45/73 (61%), Gaps = 2/73 (2%)
Frame = +1

Query: 25 QSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARV--NHTYPLSQAAEAHCDL 198
Q SL+ TRP++ YI TR+EL + E+F+ +ASG++K V N Y L A AH L
Sbjct: 255 QKGSLYATRPSLQGYITTREELTEASNELFSLIASGVIKVDVAENQRYALKDARRAHEVL 314

Query: 199 ESRKTSGCIILLP 237
ESR T G +L+P
Sbjct: 315 ESRATQGSSLLIP 327


>sp|P43903|QOR_PSEAE Quinone oxidoreductase OS=Pseudomonas
aeruginosa GN=qor PE=3 SV=2
Length = 325

Score = 60.5 bits (145), Expect = 6e-09
Identities = 28/71 (39%), Positives = 46/71 (64%)
Frame = +1

Query: 25 QSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAEAHCDLES 204
Q SL++TRPT+ Y T ++L A A E+F + G ++ +N + L++AA AH +L +
Sbjct: 255 QKGSLYVTRPTLGSYADTPEKLQAMADELFGLIERGDIRIEINQRFALAEAARAHTELAA 314

Query: 205 RKTSGCIILLP 237
R+T+G +LLP
Sbjct: 315 RRTTGSTVLLP 325


>sp|P38230|QOR_YEAST Probable quinone oxidoreductase
OS=Saccharomyces cerevisiae GN=ZTA1 PE=1 SV=1
Length = 334

Score = 47.0 bits (110), Expect = 6e-05
Identities = 27/76 (35%), Positives = 40/76 (52%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P +++ L K++ L RP + YI +E + E F V S L ++ TYPL
Sbjct: 255 PFSITRLSPKNITLVRPQLYGYIADPEEWKYYSDEFFGLVNSKKLNIKIYKTYPLRDYRT 314

Query: 184 AHCDLESRKTSGCIIL 231
A D+ESRKT G ++L
Sbjct: 315 AAADIESRKTVGKLVL 330


>sp|O74489|QOR_SCHPO Probable quinone oxidoreductase
OS=Schizosaccharomyces pombe GN=zta1 PE=1 SV=2
Length = 329

Score = 41.6 bits (96), Expect = 0.003
Identities = 22/74 (29%), Positives = 37/74 (50%)
Frame = +1

Query: 13 LSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAEAHC 192
L L ++ L RP++ YI ++ + L ++H + LS+A EAH
Sbjct: 248 LKFLSARCLKFVRPSLFGYITGHAVFEGYVSRLWKEILDNNLNIAIHHIFKLSEAKEAHD 307

Query: 193 DLESRKTSGCIILL 234
+ESR T+G ++LL
Sbjct: 308 AIESRATTGKLLLL 321


>sp|Q0MVN8|QOR_PIG Quinone oxidoreductase OS=Sus scrofa GN=CRYZ PE=2
SV=1
Length = 329

Score = 34.3 bits (77), Expect = 0.43
Identities = 20/57 (35%), Positives = 31/57 (54%), Gaps = 1/57 (1%)
Frame = +1

Query: 67 YIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAEAHCD-LESRKTSGCIILL 234
Y T++E A + + G L+ + YPL +AA+AH D + SR +G +ILL
Sbjct: 272 YSSTKEEFQQLAAALQAGMEVGWLRPVIGPVYPLEKAAQAHEDIIHSRGATGKMILL 328


>sp|P47199|QOR_MOUSE Quinone oxidoreductase OS=Mus musculus GN=Cryz
PE=2 SV=1
Length = 331

Score = 33.5 bits (75), Expect = 0.73
Identities = 20/55 (36%), Positives = 30/55 (54%), Gaps = 2/55 (3%)
Frame = +1

Query: 76 TRDELLATAGEVFTNVASGILKARVNHTYPLSQAAEAHCDL--ESRKTSGCIILL 234
T++E AG + + G +K + YPL +AA+AH D+ S KT I+LL
Sbjct: 277 TKEEFQQFAGLLQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHGSGKTGKMILLL 331


>sp|Q6AYT0|QOR_RAT Quinone oxidoreductase OS=Rattus norvegicus
GN=Cryz PE=2 SV=1
Length = 329

Score = 32.3 bits (72), Expect = 1.6
Identities = 19/58 (32%), Positives = 30/58 (51%), Gaps = 2/58 (3%)
Frame = +1

Query: 67 YIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAEAHCDL--ESRKTSGCIILL 234
+ T++E AG + + G +K + YPL +AA+AH D+ S K I+LL
Sbjct: 272 FSSTKEEFQQFAGILQAGIEKGWVKPVIGSEYPLEKAAQAHEDIIHSSGKMGKMILLL 329


>sp|Q6GM65|PLAP_XENLA Phospholipase A-2-activating protein
OS=Xenopus laevis GN=plaa PE=2 SV=2
Length = 799

Score = 32.0 bits (71), Expect = 2.1
Identities = 16/42 (38%), Positives = 22/42 (52%)
Frame = -3

Query: 243 RSWEQNDTSRGFP*FQITMGFSSLRQRICVVHPSLQYPRGHI 118
R W + +RGF Q G S+ +C++ PS YPRG I
Sbjct: 50 RLWVPDSPNRGFIELQRMSGHSNFVSCVCILPPSDLYPRGLI 91


>sp|Q9M1Y1|FBK76_ARATH F-box/Kelch-repeat protein At3g59940
OS=Arabidopsis thaliana GN=At3g59940 PE=2 SV=1
Length = 418

Score = 30.8 bits (68), Expect = 4.7
Identities = 16/46 (34%), Positives = 24/46 (52%)
Frame = -3

Query: 267 HTS*ASLCRSWEQNDTSRGFP*FQITMGFSSLRQRICVVHPSLQYP 130
H+S S+CRSW+ +SR F + +GF +C+V P P
Sbjct: 36 HSSIKSVCRSWKCVISSRSF--IKERIGFGKAESLLCLVQPLTSPP 79


tr_hit_id A7Q8Y3
Definition tr|A7Q8Y3|A7Q8Y3_VITVI Chromosome chr9 scaffold_65, whole genome shotgun sequence OS=Vitis vinifera
Align length 78
Score (bit) 119.0
E-value 9.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912194|Adiantum capillus-veneris mRNA, clone:
YMU001_000016_C02.
(560 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7Q8Y3|A7Q8Y3_VITVI Chromosome chr9 scaffold_65, whole genome... 119 9e-26
tr|A5BYL3|A5BYL3_VITVI Putative uncharacterized protein OS=Vitis... 119 9e-26
tr|P93619|P93619_VIGUN Ted2 protein OS=Vigna unguiculata GN=Ted2... 114 3e-24
tr|B6VC74|B6VC74_GOSHI Ted2 OS=Gossypium hirsutum PE=2 SV=1 114 3e-24
tr|A7Q8Y2|A7Q8Y2_VITVI Chromosome chr9 scaffold_65, whole genome... 114 5e-24
tr|A5B928|A5B928_VITVI Putative uncharacterized protein OS=Vitis... 114 5e-24
tr|B7FIV6|B7FIV6_MEDTR Putative uncharacterized protein OS=Medic... 113 6e-24
tr|Q10T48|Q10T48_ORYSJ Oxidoreductase, zinc-binding dehydrogenas... 113 8e-24
tr|Q0DW19|Q0DW19_ORYSJ Os03g0101600 protein OS=Oryza sativa subs... 113 8e-24
tr|B8AL04|B8AL04_ORYSI Putative uncharacterized protein OS=Oryza... 113 8e-24
tr|Q9FKG8|Q9FKG8_ARATH Quinone oxidoreductase OS=Arabidopsis tha... 111 3e-23
tr|A1L4Y4|A1L4Y4_ARATH At5g61510 OS=Arabidopsis thaliana PE=2 SV=1 111 3e-23
tr|A9P243|A9P243_PICSI Putative uncharacterized protein OS=Picea... 108 3e-22
tr|A9NN65|A9NN65_PICSI Putative uncharacterized protein OS=Picea... 107 6e-22
tr|Q9AUT6|Q9AUT6_ORYSA Putative quinone oxidoreductase OS=Oryza ... 101 2e-20
tr|Q8SBA7|Q8SBA7_ORYSA Putative quinone oxidoreductase OS=Oryza ... 101 2e-20
tr|Q336S6|Q336S6_ORYSJ Os10g0561100 protein OS=Oryza sativa subs... 101 2e-20
tr|B8BI87|B8BI87_ORYSI Putative uncharacterized protein OS=Oryza... 101 2e-20
tr|A9S4A9|A9S4A9_PHYPA Predicted protein OS=Physcomitrella paten... 96 1e-18
tr|A3C7B1|A3C7B1_ORYSJ Putative uncharacterized protein OS=Oryza... 95 3e-18
tr|Q41724|Q41724_ZINEL TED2 OS=Zinnia elegans PE=2 SV=1 87 6e-16
tr|A5UTC6|A5UTC6_ROSS1 Alcohol dehydrogenase, zinc-binding domai... 83 9e-15
tr|Q5YTS2|Q5YTS2_NOCFA Putative quinone oxidoreductase OS=Nocard... 80 8e-14
tr|A7NKZ1|A7NKZ1_ROSCS Alcohol dehydrogenase zinc-binding domain... 80 8e-14
tr|B8DKG1|B8DKG1_DESVM Alcohol dehydrogenase zinc-binding domain... 80 8e-14
tr|Q0S0I4|Q0S0I4_RHOSR NADPH:quinone reductase OS=Rhodococcus sp... 80 1e-13
tr|B5EHK0|B5EHK0_GEOBB Alcohol dehydrogenase zinc-binding domain... 79 1e-13
tr|Q2Z063|Q2Z063_9GAMM Probable nadph:quinone reductase, zeta-cr... 79 2e-13
tr|A9D981|A9D981_9RHIZ Probable quinone oxidoreductase protein O... 79 2e-13
tr|B8GS49|B8GS49_9GAMM Zinc-containing alcohol dehydrogenase sup... 78 4e-13

>tr|A7Q8Y3|A7Q8Y3_VITVI Chromosome chr9 scaffold_65, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033237001
PE=4 SV=1
Length = 331

Score = 119 bits (299), Expect = 9e-26
Identities = 56/78 (71%), Positives = 66/78 (84%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P L +L +KSLFLTRP++M Y TRDELL AGEVF NVASG+L+ RVNHTYPLSQAA+
Sbjct: 247 PVPLPSLGAKSLFLTRPSLMQYTATRDELLEAAGEVFANVASGVLRVRVNHTYPLSQAAQ 306

Query: 184 AHCDLESRKTSGCIILLP 237
AH DLESRKTSGC++L+P
Sbjct: 307 AHADLESRKTSGCVVLIP 324


>tr|A5BYL3|A5BYL3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029360 PE=4 SV=1
Length = 331

Score = 119 bits (299), Expect = 9e-26
Identities = 56/78 (71%), Positives = 66/78 (84%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P L +L +KSLFLTRP++M Y TRDELL AGEVF NVASG+L+ RVNHTYPLSQAA+
Sbjct: 247 PVPLPSLGAKSLFLTRPSLMQYTATRDELLEAAGEVFANVASGVLRVRVNHTYPLSQAAQ 306

Query: 184 AHCDLESRKTSGCIILLP 237
AH DLESRKTSGC++L+P
Sbjct: 307 AHADLESRKTSGCVVLIP 324


>tr|P93619|P93619_VIGUN Ted2 protein OS=Vigna unguiculata GN=Ted2
PE=2 SV=1
Length = 324

Score = 114 bits (286), Expect = 3e-24
Identities = 55/78 (70%), Positives = 67/78 (85%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P LS+L +KSLFLTRP++M Y+ TRDELL AGE+F NVASG+LK RVNHTYPLS+AA+
Sbjct: 247 PVPLSSLAAKSLFLTRPSLMQYVVTRDELLEAAGELFANVASGVLKVRVNHTYPLSEAAK 306

Query: 184 AHCDLESRKTSGCIILLP 237
AH DLE+RKTSG I+L+P
Sbjct: 307 AHEDLENRKTSGSIVLIP 324


>tr|B6VC74|B6VC74_GOSHI Ted2 OS=Gossypium hirsutum PE=2 SV=1
Length = 324

Score = 114 bits (286), Expect = 3e-24
Identities = 54/78 (69%), Positives = 65/78 (83%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P LSAL KSLFLTRP+MM Y TRDELL TAGEVF NVASG+L+ RVNH YPLS+AA+
Sbjct: 247 PVPLSALAPKSLFLTRPSMMQYTSTRDELLETAGEVFANVASGVLRVRVNHKYPLSEAAQ 306

Query: 184 AHCDLESRKTSGCIILLP 237
AH DLE+R+T+G ++L+P
Sbjct: 307 AHADLENRRTTGSVVLIP 324


>tr|A7Q8Y2|A7Q8Y2_VITVI Chromosome chr9 scaffold_65, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00033235001
PE=4 SV=1
Length = 333

Score = 114 bits (284), Expect = 5e-24
Identities = 53/78 (67%), Positives = 65/78 (83%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P L +L +K+LFLTRP++MHY TRD+LL AGEVF NVASG+L+ RVNH YPLSQAA+
Sbjct: 247 PVPLPSLGAKALFLTRPSLMHYSATRDDLLEAAGEVFANVASGVLRVRVNHKYPLSQAAQ 306

Query: 184 AHCDLESRKTSGCIILLP 237
AH DLESRKTSG ++L+P
Sbjct: 307 AHADLESRKTSGSVVLIP 324


>tr|A5B928|A5B928_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031123 PE=4 SV=1
Length = 333

Score = 114 bits (284), Expect = 5e-24
Identities = 53/78 (67%), Positives = 65/78 (83%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P L +L +K+LFLTRP++MHY TRD+LL AGEVF NVASG+L+ RVNH YPLSQAA+
Sbjct: 247 PVPLPSLGAKALFLTRPSLMHYSATRDDLLEAAGEVFANVASGVLRVRVNHKYPLSQAAQ 306

Query: 184 AHCDLESRKTSGCIILLP 237
AH DLESRKTSG ++L+P
Sbjct: 307 AHADLESRKTSGSVVLIP 324


>tr|B7FIV6|B7FIV6_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 235

Score = 113 bits (283), Expect = 6e-24
Identities = 54/78 (69%), Positives = 65/78 (83%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P LS+L +KSLFLTRPT+ Y+ TRDELL AGEVF NVASG+LK RVNHTYPLS+A +
Sbjct: 158 PVPLSSLATKSLFLTRPTLFQYVVTRDELLRAAGEVFANVASGVLKVRVNHTYPLSEAVK 217

Query: 184 AHCDLESRKTSGCIILLP 237
AH DLE+RKTSG ++L+P
Sbjct: 218 AHEDLENRKTSGSVVLIP 235


>tr|Q10T48|Q10T48_ORYSJ Oxidoreductase, zinc-binding dehydrogenase
family protein, expressed (Putative uncharacterized
protein) OS=Oryza sativa subsp. japonica
GN=LOC_Os03g01190 PE=4 SV=1
Length = 371

Score = 113 bits (282), Expect = 8e-24
Identities = 54/81 (66%), Positives = 65/81 (80%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P LS L SKSL +TRP++MHY TRDELL +AGEVF NV SG+L+ RVNHTYPLSQAA
Sbjct: 291 PIPLSDLASKSLLVTRPSLMHYTATRDELLESAGEVFANVGSGVLRIRVNHTYPLSQAAR 350

Query: 184 AHCDLESRKTSGCIILLPGSA 246
AH DL++RKT+G I+L+P A
Sbjct: 351 AHADLQARKTTGSILLIPDDA 371


>tr|Q0DW19|Q0DW19_ORYSJ Os03g0101600 protein OS=Oryza sativa subsp.
japonica GN=Os03g0101600 PE=4 SV=1
Length = 328

Score = 113 bits (282), Expect = 8e-24
Identities = 54/81 (66%), Positives = 65/81 (80%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P LS L SKSL +TRP++MHY TRDELL +AGEVF NV SG+L+ RVNHTYPLSQAA
Sbjct: 248 PIPLSDLASKSLLVTRPSLMHYTATRDELLESAGEVFANVGSGVLRIRVNHTYPLSQAAR 307

Query: 184 AHCDLESRKTSGCIILLPGSA 246
AH DL++RKT+G I+L+P A
Sbjct: 308 AHADLQARKTTGSILLIPDDA 328


>tr|B8AL04|B8AL04_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_09616 PE=4 SV=1
Length = 328

Score = 113 bits (282), Expect = 8e-24
Identities = 54/81 (66%), Positives = 65/81 (80%)
Frame = +1

Query: 4 PNTLSALQSKSLFLTRPTMMHYIGTRDELLATAGEVFTNVASGILKARVNHTYPLSQAAE 183
P LS L SKSL +TRP++MHY TRDELL +AGEVF NV SG+L+ RVNHTYPLSQAA
Sbjct: 248 PIPLSDLASKSLLVTRPSLMHYTATRDELLESAGEVFANVGSGVLRIRVNHTYPLSQAAR 307

Query: 184 AHCDLESRKTSGCIILLPGSA 246
AH DL++RKT+G I+L+P A
Sbjct: 308 AHADLQARKTTGSILLIPDDA 328