BP912226
Clone id YMU001_000016_F02
Library
Length 463
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000016_F02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGGAAGAATTCGCGGCCGCAGGAATTTTGTTTTTTTTTTTTTGAAGCCAATTTTGATAA
AAGATCAGCTATAGATACACAATCGGCTGATGTCAATTCAACTCCATATTAGTACCACCA
AACTAGAAGCTACAGTTTGCAATTCAAGATGACAAAGCAAGATCTTTTAAGGAGAGATTT
AGGACAATAGCAGCCAAGCGGCTATACATGGTTGGTTATCATAGGGACTTATCATTGTGT
TACATGAGGAAATCTTGAAAGATTTCATGCATGACAAAGTTTCTCCATCTTTAATGTCAC
CAAAAACATTAAGAAGACTCTTTACAAAATCAACAAAGGTCCCTGTATTTAGCTGAACTC
AGGATAGTTCGGAGCTTGAGAAATAGACCTAAAAACAGCACTTGTTACTTCTAATGCGGC
TACCAGCATATATGGTGGTAACAGGCATATAGAATAGTACGTG
■■Homology search results ■■ -
sp_hit_id P46756
Definition sp|P46756|RT07_ACACA Ribosomal protein S7, mitochondrial OS=Acanthamoeba castellanii
Align length 55
Score (bit) 30.8
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912226|Adiantum capillus-veneris mRNA, clone:
YMU001_000016_F02.
(420 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P46756|RT07_ACACA Ribosomal protein S7, mitochondrial OS=Acan... 31 2.2

>sp|P46756|RT07_ACACA Ribosomal protein S7, mitochondrial
OS=Acanthamoeba castellanii GN=RPS7 PE=3 SV=1
Length = 337

Score = 30.8 bits (68), Expect = 2.2
Identities = 18/55 (32%), Positives = 29/55 (52%)
Frame = +3

Query: 78 N*KLQFAIQDDKARSFKERFRTIAAKRLYMVGYHRDLSLCYMRKS*KISCMTKFL 242
N K +F ++ + FK R + KRLY +GY + CY+R+ + + KFL
Sbjct: 52 NKKGKFRVKKLRLGKFK---RALFVKRLYKLGYKKRYFFCYLRQRIESIRLKKFL 103


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912226|Adiantum capillus-veneris mRNA, clone:
YMU001_000016_F02.
(420 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******