BP912273
Clone id YMU001_000017_B05
Library
Length 450
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000017_B05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATGGGCCTAACCTTACACTGACAAAAGCTGAGGAATTCCTCAACATCAAACTAAAATGTT
CCTTCAAACTCGAAAAGGGCAGATTGAAGTCCAGACAATATTCAAGAGCAGTGCTTAAAG
GAAAGCTGGATTTCATTTTGCCACTGCTAATAACCACAAAACAGGGAGATTAGCCTCTTC
CTTGAAGAAACACTCGTTCTCAACTTATAAGGCCACAACTCTGGAGGAAGAGAAACTAAG
CATGCTTAGAGTAGTGTGAAGGCACCATGACTGATTGCACATACTTGCATTCCAGTATTG
AGGGTGTAACATCACACCTGTCTGAGATAGCATCACATTGCTCTCAACACCTGAAACAAT
GGTGGCCTGTCTTCAGATGCCCTTCTGGAAACCCTGCTGTTGTCATCATCAATTTGATGG
AAGTGTGCAAGCCACTATAACACTATAATG
■■Homology search results ■■ -
sp_hit_id Q1WUJ4
Definition sp|Q1WUJ4|NUSB_LACS1 N utilization substance protein B homolog OS=Lactobacillus salivarius subsp. salivarius (strain UCC118)
Align length 52
Score (bit) 32.3
E-value 0.95
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912273|Adiantum capillus-veneris mRNA, clone:
YMU001_000017_B05.
(450 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q1WUJ4|NUSB_LACS1 N utilization substance protein B homolog O... 32 0.95
sp|Q8RAD1|NUSB_THETN N utilization substance protein B homolog O... 31 2.8
sp|P58960|GR39B_DROME Putative gustatory receptor 39b OS=Drosoph... 29 8.0

>sp|Q1WUJ4|NUSB_LACS1 N utilization substance protein B homolog
OS=Lactobacillus salivarius subsp. salivarius (strain
UCC118) GN=nusB PE=3 SV=1
Length = 131

Score = 32.3 bits (72), Expect = 0.95
Identities = 14/52 (26%), Positives = 30/52 (57%)
Frame = +3

Query: 270 TDCTYLHSSIEGVTSHLSEIASHCSQHLKQWWPVFRCPSGNPAVVIINLMEV 425
+D +YL+ ++GV H SEI +++L++ W + R + ++ I + E+
Sbjct: 42 SDLSYLNELVDGVLDHQSEIDMEITKYLRKNWNIGRLNKTDLIILRIAIFEI 93


>sp|Q8RAD1|NUSB_THETN N utilization substance protein B homolog
OS=Thermoanaerobacter tengcongensis GN=nusB PE=3 SV=1
Length = 140

Score = 30.8 bits (68), Expect = 2.8
Identities = 13/48 (27%), Positives = 26/48 (54%)
Frame = +3

Query: 282 YLHSSIEGVTSHLSEIASHCSQHLKQWWPVFRCPSGNPAVVIINLMEV 425
Y+ ++ G HL EI ++ K WP++R P + A++ ++ E+
Sbjct: 43 YIEGTVRGTVEHLEEIDREIEKYSKD-WPLYRMPRIDLAILRCSMYEM 89


>sp|P58960|GR39B_DROME Putative gustatory receptor 39b OS=Drosophila
melanogaster GN=Gr39b PE=2 SV=1
Length = 369

Score = 29.3 bits (64), Expect = 8.0
Identities = 12/39 (30%), Positives = 26/39 (66%)
Frame = +3

Query: 33 EFLNIKLKCSFKLEKGRLKSRQYSRAVLKGKLDFILPLL 149
++L ++L+C K+ GRLK + Y++ + G + F++ +L
Sbjct: 98 KYLGLRLQCELKIHVGRLKWQSYAKILALG-IGFLVTVL 135


tr_hit_id Q14MH2
Definition tr|Q14MH2|Q14MH2_SPICI Hypothetical transcription factor involved in antitermination transcription regulator protein OS=Spiroplasma citri
Align length 46
Score (bit) 35.4
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912273|Adiantum capillus-veneris mRNA, clone:
YMU001_000017_B05.
(450 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q14MH2|Q14MH2_SPICI Hypothetical transcription factor involve... 35 1.4
tr|Q98LA1|Q98LA1_RHILO Mll1116 protein OS=Rhizobium loti GN=mll1... 35 1.9
tr|B0S758|B0S758_DANRE Novel protein similar to H.sapiens TTN, t... 33 9.4
tr|A5X6X5|A5X6X5_DANRE Titin a OS=Danio rerio GN=ttna PE=1 SV=1 33 9.4

>tr|Q14MH2|Q14MH2_SPICI Hypothetical transcription factor involved
in antitermination transcription regulator protein
OS=Spiroplasma citri GN=nusB PE=4 SV=1
Length = 126

Score = 35.4 bits (80), Expect = 1.4
Identities = 14/46 (30%), Positives = 28/46 (60%)
Frame = +3

Query: 291 SSIEGVTSHLSEIASHCSQHLKQWWPVFRCPSGNPAVVIINLMEVC 428
+ +E + ++LS+I + +QHLK W R + + AV++ + E+C
Sbjct: 45 NQVEEILANLSDIIAKINQHLKPGWDFVRLSNYHKAVLVYGVYEIC 90


>tr|Q98LA1|Q98LA1_RHILO Mll1116 protein OS=Rhizobium loti GN=mll1116
PE=4 SV=1
Length = 602

Score = 35.0 bits (79), Expect = 1.9
Identities = 17/48 (35%), Positives = 28/48 (58%), Gaps = 2/48 (4%)
Frame = +3

Query: 270 TDCTYLHSSIEGVTSHLSEIASHCSQHLKQWWP--VFRCPSGNPAVVI 407
TD T+ ++ IE S+L ++ +H+ QW P +F P+GN AV +
Sbjct: 511 TDVTFQNAEIEWSLSYLEKMVQCWREHIYQWTPEDMFGIPTGNGAVAV 558


>tr|B0S758|B0S758_DANRE Novel protein similar to H.sapiens TTN, titin
(TTN) (Fragment) OS=Danio rerio GN=ttna PE=1 SV=1
Length = 7601

Score = 32.7 bits (73), Expect = 9.4
Identities = 27/81 (33%), Positives = 35/81 (43%), Gaps = 3/81 (3%)
Frame = -2

Query: 242 CLVSLPPEL---WPYKLRTSVSSRKRLISLFCGY*QWQNEIQLSFKHCS*ILSGLQSALF 72
C VS PEL W + + SR+ +S N QL LQS
Sbjct: 5733 CKVSGTPELKVKWSKDGKEVIPSRQHSLSYI------NNVSQLK----------LQSVQL 5776

Query: 71 EFEGTF*FDVEEFLSFCQCKV 9
E +GT+ F+V +S CQCKV
Sbjct: 5777 EDKGTYVFEVSNHISACQCKV 5797


>tr|A5X6X5|A5X6X5_DANRE Titin a OS=Danio rerio GN=ttna PE=1 SV=1
Length = 32757

Score = 32.7 bits (73), Expect = 9.4
Identities = 27/81 (33%), Positives = 35/81 (43%), Gaps = 3/81 (3%)
Frame = -2

Query: 242 CLVSLPPEL---WPYKLRTSVSSRKRLISLFCGY*QWQNEIQLSFKHCS*ILSGLQSALF 72
C VS PEL W + + SR+ +S N QL LQS
Sbjct: 6227 CKVSGTPELKVKWSKDGKEVIPSRQHSLSYI------NNVSQLK----------LQSVQL 6270

Query: 71 EFEGTF*FDVEEFLSFCQCKV 9
E +GT+ F+V +S CQCKV
Sbjct: 6271 EDKGTYVFEVSNHISACQCKV 6291