BP912289
Clone id YMU001_000017_C10
Library
Length 312
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000017_C10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTCTTCATTCATTGCATCATCCCAATGCACATTTCCAACTGCATCCTCAAAACATGTGGG
CTCCACATCCTGTATCACCTTAGCCATGTAGGCTTGGTGATGCGCTAGATACCCATCATA
AGTCAATTTCTGAACTGGATTTCTGACTCTGTAAGATCTGCGTGGTCCTGGGTCACTCCT
TTGCCGTCTAGCATCTTCTTGTACTTTCCTTACACCAGGTGTCCTGACAGCCGGAATTCC
AAATTCCTCATCAAGACTTTGTTCAGAACCATCTGAATCCATGTCTACATGTGAAAAGAC
TGATGATGCATC
■■Homology search results ■■ -
sp_hit_id Q5ZKN3
Definition sp|Q5ZKN3|PHTF2_CHICK Putative homeodomain transcription factor 2 OS=Gallus gallus
Align length 75
Score (bit) 32.7
E-value 0.57
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912289|Adiantum capillus-veneris mRNA, clone:
YMU001_000017_C10.
(312 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5ZKN3|PHTF2_CHICK Putative homeodomain transcription factor ... 33 0.57
sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein ... 31 2.2
sp|A3N3D8|CYSI_ACTP2 Sulfite reductase [NADPH] hemoprotein beta-... 30 2.9
sp|Q8TXW5|SYT_METKA Threonyl-tRNA synthetase OS=Methanopyrus kan... 30 3.7
sp|Q8VSR0|CYSI_ACTPL Sulfite reductase [NADPH] hemoprotein beta-... 30 3.7
sp|Q7NHU4|CINAL_GLOVI CinA-like protein OS=Gloeobacter violaceus... 30 3.7
sp|P48893|ATP6_ALBCO ATP synthase subunit a OS=Albinaria coerule... 30 3.7
sp|Q14966|ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens GN... 30 4.9
sp|Q17Q06|EIF3C_AEDAE Eukaryotic translation initiation factor 3... 29 6.4
sp|Q65NA1|MTLD_BACLD Mannitol-1-phosphate 5-dehydrogenase OS=Bac... 29 8.3
sp|Q64P77|ISPD_BACFR 2-C-methyl-D-erythritol 4-phosphate cytidyl... 29 8.3
sp|Q62956|ERBB4_RAT Receptor tyrosine-protein kinase erbB-4 OS=R... 29 8.3
sp|Q8IXL6|DMP4_HUMAN Dentin matrix protein 4 OS=Homo sapiens GN=... 29 8.3

>sp|Q5ZKN3|PHTF2_CHICK Putative homeodomain transcription factor 2
OS=Gallus gallus GN=PHTF2 PE=2 SV=1
Length = 752

Score = 32.7 bits (73), Expect = 0.57
Identities = 20/75 (26%), Positives = 35/75 (46%)
Frame = -1

Query: 279 DSDGSEQSLDEEFGIPAVRTPGVRKVQEDARRQRSDPGPRRSYRVRNPVQKLTYDGYLAH 100
+S S ++ E FG P+ R V + S+ GP Y +R V++ + DG L +
Sbjct: 269 ESGWSTTTMRETFGTPSHHKETHRTVTNLSDEVSSEEGPETGYSLRRNVERTSSDGTLRN 328

Query: 99 HQAYMAKVIQDVEPT 55
+++ K +E T
Sbjct: 329 RKSHHYKKHYPLEDT 343


>sp|Q9UQ35|SRRM2_HUMAN Serine/arginine repetitive matrix protein 2
OS=Homo sapiens GN=SRRM2 PE=1 SV=2
Length = 2752

Score = 30.8 bits (68), Expect = 2.2
Identities = 18/62 (29%), Positives = 26/62 (41%)
Frame = -1

Query: 309 ASSVFSHVDMDSDGSEQSLDEEFGIPAVRTPGVRKVQEDARRQRSDPGPRRSYRVRNPVQ 130
+SS S S S S P+ PG + + + A ++ PG RRS R P+
Sbjct: 2624 SSSSSSSSSSSSSSSSSSSSSSSSSPSPAKPGPQALPKPASPKKPPPGERRSRSPRKPID 2683

Query: 129 KL 124
L
Sbjct: 2684 SL 2685


>sp|A3N3D8|CYSI_ACTP2 Sulfite reductase [NADPH] hemoprotein
beta-component OS=Actinobacillus pleuropneumoniae
serotype 5b (strain L20) GN=cysI PE=3 SV=1
Length = 588

Score = 30.4 bits (67), Expect = 2.9
Identities = 22/65 (33%), Positives = 30/65 (46%)
Frame = -1

Query: 216 GVRKVQEDARRQRSDPGPRRSYRVRNPVQKLTYDGYLAHHQAYMAKVIQDVEPTCFEDAV 37
GV K Q D RSD R++ RVR VQ +T DG+ A + M + P F +
Sbjct: 296 GVVKTQRDFGN-RSD---RKNARVRYTVQNMTLDGFRAEVERCMNIKFEPTRPYEFTERG 351

Query: 36 GNVHW 22
+ W
Sbjct: 352 DRIGW 356


>sp|Q8TXW5|SYT_METKA Threonyl-tRNA synthetase OS=Methanopyrus
kandleri GN=thrS PE=3 SV=1
Length = 624

Score = 30.0 bits (66), Expect = 3.7
Identities = 14/40 (35%), Positives = 22/40 (55%)
Frame = -1

Query: 261 QSLDEEFGIPAVRTPGVRKVQEDARRQRSDPGPRRSYRVR 142
++L + G V TP + + EDA R+ +D R YR+R
Sbjct: 237 ENLMADLGAAVVETPVMYDLSEDAIREHADKFGERQYRIR 276


>sp|Q8VSR0|CYSI_ACTPL Sulfite reductase [NADPH] hemoprotein
beta-component OS=Actinobacillus pleuropneumoniae
GN=cysI PE=3 SV=1
Length = 588

Score = 30.0 bits (66), Expect = 3.7
Identities = 21/65 (32%), Positives = 30/65 (46%)
Frame = -1

Query: 216 GVRKVQEDARRQRSDPGPRRSYRVRNPVQKLTYDGYLAHHQAYMAKVIQDVEPTCFEDAV 37
GV K Q D RSD R++ RVR +Q +T DG+ A + M + P F +
Sbjct: 296 GVVKTQRDFGN-RSD---RKNARVRYTIQNMTLDGFRAEVERCMNIKFEPTRPYEFTERG 351

Query: 36 GNVHW 22
+ W
Sbjct: 352 DRIGW 356


>sp|Q7NHU4|CINAL_GLOVI CinA-like protein OS=Gloeobacter violaceus
GN=glr2441 PE=3 SV=1
Length = 426

Score = 30.0 bits (66), Expect = 3.7
Identities = 14/37 (37%), Positives = 22/37 (59%)
Frame = -1

Query: 279 DSDGSEQSLDEEFGIPAVRTPGVRKVQEDARRQRSDP 169
D D + Q+L E F +P VR P + + E+ R+R+ P
Sbjct: 75 DDDLTHQTLAEHFEVPLVRHPALLALIEERFRERNRP 111


>sp|P48893|ATP6_ALBCO ATP synthase subunit a OS=Albinaria coerulea
GN=ATP6 PE=3 SV=1
Length = 214

Score = 30.0 bits (66), Expect = 3.7
Identities = 12/31 (38%), Positives = 18/31 (58%)
Frame = +1

Query: 145 DSVRSAWSWVTPLPSSIFLYFPYTRCPDSRN 237
D + S WSW+TP+ S+F+ + T D N
Sbjct: 10 DGMTSLWSWLTPMFLSVFMIWNKTWSMDQNN 40


>sp|Q14966|ZN638_HUMAN Zinc finger protein 638 OS=Homo sapiens
GN=ZNF638 PE=1 SV=2
Length = 1978

Score = 29.6 bits (65), Expect = 4.9
Identities = 14/30 (46%), Positives = 17/30 (56%)
Frame = -1

Query: 237 IPAVRTPGVRKVQEDARRQRSDPGPRRSYR 148
+P+ R G RK E RR+ P PRRS R
Sbjct: 469 LPSRRNEGNRKENETPRRRSHSPSPRRSRR 498


>sp|Q17Q06|EIF3C_AEDAE Eukaryotic translation initiation factor 3
subunit C OS=Aedes aegypti GN=eIF3-S8 PE=3 SV=1
Length = 910

Score = 29.3 bits (64), Expect = 6.4
Identities = 13/31 (41%), Positives = 19/31 (61%)
Frame = -1

Query: 285 DMDSDGSEQSLDEEFGIPAVRTPGVRKVQED 193
DMDSD E S DEE ++R ++K ++D
Sbjct: 218 DMDSDSDESSSDEETQYTSIRERFLKKAEKD 248


>sp|Q65NA1|MTLD_BACLD Mannitol-1-phosphate 5-dehydrogenase
OS=Bacillus licheniformis (strain DSM 13 / ATCC 14580)
GN=mtlD PE=3 SV=1
Length = 379

Score = 28.9 bits (63), Expect = 8.3
Identities = 14/32 (43%), Positives = 16/32 (50%)
Frame = -1

Query: 123 TYDGYLAHHQAYMAKVIQDVEPTCFEDAVGNV 28
TYD H+AYM K+I E C D V V
Sbjct: 261 TYDFTQEEHRAYMTKIIGRFENECLSDDVTRV 292


tr_hit_id Q0KIU3
Definition tr|Q0KIU3|Q0KIU3_SOLDE Integrase core domain containing protein OS=Solanum demissum
Align length 100
Score (bit) 42.7
E-value 0.009
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912289|Adiantum capillus-veneris mRNA, clone:
YMU001_000017_C10.
(312 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0KIU3|Q0KIU3_SOLDE Integrase core domain containing protein ... 43 0.009
tr|A5ART6|A5ART6_VITVI Putative uncharacterized protein OS=Vitis... 43 0.009
tr|A5AIJ8|A5AIJ8_VITVI Putative uncharacterized protein OS=Vitis... 43 0.009
tr|A5BEI8|A5BEI8_VITVI Putative uncharacterized protein OS=Vitis... 41 0.026
tr|A5BLV0|A5BLV0_VITVI Putative uncharacterized protein OS=Vitis... 41 0.034
tr|Q8L700|Q8L700_ARATH Putative uncharacterized protein (Putativ... 39 0.099
tr|O22175|O22175_ARATH Putative retroelement pol polyprotein OS=... 39 0.099
tr|Q9FL75|Q9FL75_ARATH Retroelement pol polyprotein-like OS=Arab... 36 1.1
tr|O65452|O65452_ARATH LTR retrotransposon like protein OS=Arabi... 36 1.1
tr|B2WAZ0|B2WAZ0_PYRTR Putative uncharacterized protein OS=Pyren... 36 1.1
tr|O81903|O81903_ARATH Putative transposable element OS=Arabidop... 35 1.4
tr|Q01J50|Q01J50_ORYSA OSIGBa0145M07.7 protein OS=Oryza sativa G... 35 2.5
tr|A5ARV9|A5ARV9_VITVI Putative uncharacterized protein OS=Vitis... 35 2.5
tr|Q5NQQ5|Q5NQQ5_ZYMMO Putative uncharacterized protein OS=Zymom... 34 3.2
tr|Q9RNJ6|Q9RNJ6_ZYMMO Putative uncharacterized protein OS=Zymom... 34 3.2
tr|A5BZM8|A5BZM8_VITVI Putative uncharacterized protein OS=Vitis... 34 3.2
tr|Q9ZPU4|Q9ZPU4_ARATH Putative retroelement pol polyprotein OS=... 34 4.2
tr|Q7S1T6|Q7S1T6_NEUCR Putative uncharacterized protein OS=Neuro... 34 4.2
tr|B3M006|B3M006_DROAN GF18861 OS=Drosophila ananassae GN=GF1886... 33 5.5
tr|Q0CJH0|Q0CJH0_ASPTN Predicted protein OS=Aspergillus terreus ... 33 5.5
tr|A5C540|A5C540_VITVI Putative uncharacterized protein OS=Vitis... 33 9.3
tr|A5BNR5|A5BNR5_VITVI Putative uncharacterized protein OS=Vitis... 33 9.3
tr|A5BDR0|A5BDR0_VITVI Putative uncharacterized protein OS=Vitis... 33 9.3
tr|B0S6K9|B0S6K9_DANRE Novel protein similar to vertebrate IQ mo... 33 9.3

>tr|Q0KIU3|Q0KIU3_SOLDE Integrase core domain containing protein
OS=Solanum demissum GN=SDM1_25t00011 PE=4 SV=1
Length = 716

Score = 42.7 bits (99), Expect = 0.009
Identities = 30/100 (30%), Positives = 46/100 (46%), Gaps = 8/100 (8%)
Frame = -1

Query: 276 SDGSEQSLDEEFGIPAVRTPGVRKVQEDARRQRSDPGPRRSYRVRNPVQKLTYD-----G 112
S ++ S+D+ +P T RK + R P + Y + TY G
Sbjct: 612 STDTDVSIDDNVSLPTSPTTQTRK----STRHFKPPTWMQDYVCKPTAHTCTYSLSVVLG 667

Query: 111 YLA---HHQAYMAKVIQDVEPTCFEDAVGNVHWDDAMNEE 1
Y + +QAY+AK+ D EPT F++AV + W +AM E
Sbjct: 668 YSSLSPKYQAYIAKMFTDSEPTSFKEAVKDPRWIEAMQSE 707


>tr|A5ART6|A5ART6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_028058 PE=4 SV=1
Length = 1125

Score = 42.7 bits (99), Expect = 0.009
Identities = 16/42 (38%), Positives = 26/42 (61%)
Frame = -1

Query: 126 LTYDGYLAHHQAYMAKVIQDVEPTCFEDAVGNVHWDDAMNEE 1
++Y Y H+++ A V QD+EPT + +A + HW +AM E
Sbjct: 608 VSYHRYSPQHRSFTAAVSQDIEPTSYAEATSHSHWQEAMQSE 649


>tr|A5AIJ8|A5AIJ8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031733 PE=4 SV=1
Length = 1322

Score = 42.7 bits (99), Expect = 0.009
Identities = 16/42 (38%), Positives = 26/42 (61%)
Frame = -1

Query: 126 LTYDGYLAHHQAYMAKVIQDVEPTCFEDAVGNVHWDDAMNEE 1
++Y Y H+++ A V QD+EPT + +A + HW +AM E
Sbjct: 813 VSYHRYSPQHRSFTAAVSQDIEPTSYAEAASHSHWQEAMQSE 854


>tr|A5BEI8|A5BEI8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_043423 PE=4 SV=1
Length = 1059

Score = 41.2 bits (95), Expect = 0.026
Identities = 15/42 (35%), Positives = 25/42 (59%)
Frame = -1

Query: 126 LTYDGYLAHHQAYMAKVIQDVEPTCFEDAVGNVHWDDAMNEE 1
++Y Y H+++ V QD+EPT + +A + HW +AM E
Sbjct: 905 VSYHHYSPQHRSFTTAVSQDIEPTSYAEAASHSHWQEAMQSE 946


>tr|A5BLV0|A5BLV0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_033389 PE=4 SV=1
Length = 1279

Score = 40.8 bits (94), Expect = 0.034
Identities = 15/42 (35%), Positives = 25/42 (59%)
Frame = -1

Query: 126 LTYDGYLAHHQAYMAKVIQDVEPTCFEDAVGNVHWDDAMNEE 1
++Y Y H+++ A V QD+EPT + + + HW +AM E
Sbjct: 790 VSYHRYSPQHRSFTAAVSQDIEPTSYAEXASHSHWQEAMQSE 831


>tr|Q8L700|Q8L700_ARATH Putative uncharacterized protein (Putative
retroelement pol polyprotein) (At2g23330) OS=Arabidopsis
thaliana GN=At2g23330 PE=2 SV=1
Length = 776

Score = 39.3 bits (90), Expect = 0.099
Identities = 18/42 (42%), Positives = 27/42 (64%)
Frame = -1

Query: 126 LTYDGYLAHHQAYMAKVIQDVEPTCFEDAVGNVHWDDAMNEE 1
LT GY A+H A+MA ++ EP F+DA+ W +AM++E
Sbjct: 245 LTNSGYSANHIAFMAAILDSNEPKHFKDAILIKEWCEAMSKE 286


>tr|O22175|O22175_ARATH Putative retroelement pol polyprotein
OS=Arabidopsis thaliana GN=At2g23330 PE=2 SV=1
Length = 1496

Score = 39.3 bits (90), Expect = 0.099
Identities = 18/42 (42%), Positives = 27/42 (64%)
Frame = -1

Query: 126 LTYDGYLAHHQAYMAKVIQDVEPTCFEDAVGNVHWDDAMNEE 1
LT GY A+H A+MA ++ EP F+DA+ W +AM++E
Sbjct: 965 LTNSGYSANHIAFMAAILDSNEPKHFKDAILIKEWCEAMSKE 1006


>tr|Q9FL75|Q9FL75_ARATH Retroelement pol polyprotein-like
OS=Arabidopsis thaliana PE=4 SV=1
Length = 1109

Score = 35.8 bits (81), Expect = 1.1
Identities = 14/46 (30%), Positives = 29/46 (63%)
Frame = -1

Query: 138 PVQKLTYDGYLAHHQAYMAKVIQDVEPTCFEDAVGNVHWDDAMNEE 1
P K++ + + + H+A++A V +EPT + +A+ + W +AM+ E
Sbjct: 574 PYSKMSCNRFTSSHKAFLAAVTAGMEPTTYNEAMVDKAWREAMSAE 619


>tr|O65452|O65452_ARATH LTR retrotransposon like protein
OS=Arabidopsis thaliana GN=AT4g22040 PE=2 SV=1
Length = 1109

Score = 35.8 bits (81), Expect = 1.1
Identities = 14/46 (30%), Positives = 29/46 (63%)
Frame = -1

Query: 138 PVQKLTYDGYLAHHQAYMAKVIQDVEPTCFEDAVGNVHWDDAMNEE 1
P K++ + + + H+A++A V +EPT + +A+ + W +AM+ E
Sbjct: 574 PYSKMSCNRFTSSHKAFLAAVTAGMEPTTYNEAMVDKAWREAMSAE 619


>tr|B2WAZ0|B2WAZ0_PYRTR Putative uncharacterized protein
OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP)
GN=PTRG_07453 PE=4 SV=1
Length = 368

Score = 35.8 bits (81), Expect = 1.1
Identities = 24/79 (30%), Positives = 37/79 (46%), Gaps = 1/79 (1%)
Frame = -1

Query: 261 QSLDEEFGIPAVRTPGVRKVQEDARRQRSDPGPRRSYRVRNPVQKLTYDGYLAHHQAYMA 82
Q+LD G+ + + V + A + + + Y NPV Y+G +A+ AY A
Sbjct: 189 QTLDATCGVDSAQCKTV--MDGFALQLLQENACKSDYNSDNPVVLQAYNGLIAYQPAYKA 246

Query: 81 KVIQDVEPT-CFEDAVGNV 28
+ D E CF DAV N+
Sbjct: 247 SCLHDKEGNYCFADAVSNM 265