BP912290
Clone id YMU001_000017_C12
Library
Length 479
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000017_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCGTGATATTGTCACTTTTAGTGCATCGGTAGATGGACTCTGCAGTGAAGGAAGAATGCA
TGAAGCTCATAAAATGTGGGAGGACATAAACATGAAGGGCTTGCTCATGAACAAGAGGTC
TGCTAGGTAGTAGTTCTTTGAGAATGGATCTCATTTATGATTGTGCATGAGCAATGCTCG
TAACGCACTGCAGAAGGCACCGATCTATATAAAGACAAAGAACTCATCGGTAGCTGTTGA
CATGATAGCTTATTTAAACAAATGGCCGGGAGATGTACTTACATTTGTGTATCGGTCTAT
TTTACCTCCTTTGGAAATATTGTGACAGTCCACTTTCCATTACATAATTACACTCATATG
CATATGTCAAGCACCCGCACCCAAATAGGCACCAAATAAATGAAGTGCAGCTAAGATTTA
TTTTTTCAGCAGTGAACCTTTGATTGAAGGCATTGTACTGATAAGGGCGTATGCACAAT
■■Homology search results ■■ -
sp_hit_id Q9ZUE9
Definition sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protein At2g06000 OS=Arabidopsis thaliana
Align length 36
Score (bit) 40.8
E-value 0.003
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912290|Adiantum capillus-veneris mRNA, clone:
YMU001_000017_C12.
(479 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protei... 41 0.003
sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protei... 37 0.060
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protei... 36 0.10
sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containi... 35 0.13
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protei... 35 0.18
sp|Q9SFV9|PP218_ARATH Pentatricopeptide repeat-containing protei... 35 0.23
sp|Q1PFC5|PP130_ARATH Pentatricopeptide repeat-containing protei... 35 0.23
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa s... 34 0.30
sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein... 34 0.30
sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protei... 34 0.30
sp|P0C894|PP143_ARATH Putative pentatricopeptide repeat-containi... 34 0.30
sp|Q9FND8|PP409_ARATH Pentatricopeptide repeat-containing protei... 34 0.39
sp|Q9LVQ5|PP432_ARATH Pentatricopeptide repeat-containing protei... 33 0.51
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protei... 33 0.51
sp|Q9LSL9|PP445_ARATH Pentatricopeptide repeat-containing protei... 33 0.67
sp|Q9SAD9|PPR40_ARATH Pentatricopeptide repeat-containing protei... 33 0.87
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protei... 33 0.87
sp|Q9C6S6|PPR67_ARATH Putative pentatricopeptide repeat-containi... 32 1.1
sp|Q9FIT7|PP442_ARATH Pentatricopeptide repeat-containing protei... 32 1.1
sp|Q9SAJ5|PP133_ARATH Pentatricopeptide repeat-containing protei... 32 1.1
sp|P0C7Q7|PPR38_ARATH Putative pentatricopeptide repeat-containi... 32 1.5
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protei... 32 1.5
sp|Q9FMF6|PP444_ARATH Pentatricopeptide repeat-containing protei... 32 1.5
sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protei... 32 1.5
sp|P0C8Q6|PP368_ARATH Putative pentatricopeptide repeat-containi... 32 1.5
sp|Q0WPZ6|PP158_ARATH Pentatricopeptide repeat-containing protei... 32 1.5
sp|Q9SI78|PPR93_ARATH Pentatricopeptide repeat-containing protei... 32 1.9
sp|Q9FLJ4|PP440_ARATH Pentatricopeptide repeat-containing protei... 32 1.9
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protei... 32 1.9
sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protei... 32 1.9

>sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protein
At2g06000 OS=Arabidopsis thaliana GN=At2g06000 PE=2 SV=1
Length = 536

Score = 40.8 bits (94), Expect = 0.003
Identities = 13/36 (36%), Positives = 26/36 (72%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D+VTF++ +DG C G++ + ++WE++N +G+ N
Sbjct: 346 DVVTFTSLIDGYCRVGQVSQGFRLWEEMNARGMFPN 381



Score = 31.6 bits (70), Expect = 1.9
Identities = 11/33 (33%), Positives = 21/33 (63%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGL 103
D+VT+++ + G C G+M EA + +D+ G+
Sbjct: 276 DVVTYTSMISGYCKAGKMREASSLLDDMLRLGI 308


>sp|Q3ECK2|PPR92_ARATH Pentatricopeptide repeat-containing protein
At1g62680, mitochondrial OS=Arabidopsis thaliana
GN=At1g62680 PE=2 SV=2
Length = 548

Score = 36.6 bits (83), Expect = 0.060
Identities = 13/36 (36%), Positives = 24/36 (66%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
DIVT++ + GLC++G +HE ++ + +GL+ N
Sbjct: 469 DIVTYTTMMSGLCTKGLLHEVEALYTKMKQEGLMKN 504



Score = 33.9 bits (76), Expect = 0.39
Identities = 15/34 (44%), Positives = 25/34 (73%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLL 106
DIVT+S+ ++GLC R+ EA++M++ + KG L
Sbjct: 294 DIVTYSSLINGLCLHDRIDEANQMFDLMVSKGCL 327



Score = 32.7 bits (73), Expect = 0.87
Identities = 12/33 (36%), Positives = 23/33 (69%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGL 103
DIVT++ + G+C G++ EA ++ +++KGL
Sbjct: 434 DIVTYTTVIRGMCKTGKVEEAWSLFCSLSLKGL 466



Score = 32.3 bits (72), Expect = 1.1
Identities = 13/36 (36%), Positives = 23/36 (63%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
DIV ++A +D LC R+++A +++I KG+ N
Sbjct: 189 DIVAYNAIIDSLCKTKRVNDAFDFFKEIERKGIRPN 224



Score = 30.8 bits (68), Expect = 3.3
Identities = 9/36 (25%), Positives = 24/36 (66%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D+V+++ ++G C R+ + K++ +++ +GL+ N
Sbjct: 329 DVVSYNTLINGFCKAKRVEDGMKLFREMSQRGLVSN 364



Score = 29.3 bits (64), Expect = 9.6
Identities = 12/36 (33%), Positives = 23/36 (63%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
++VT++A V+GLC+ R +A ++ D+ K + N
Sbjct: 224 NVVTYTALVNGLCNSSRWSDAARLLSDMIKKKITPN 259


>sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protein
At3g53700, chloroplastic OS=Arabidopsis thaliana
GN=MEE40 PE=2 SV=1
Length = 754

Score = 35.8 bits (81), Expect = 0.10
Identities = 15/33 (45%), Positives = 20/33 (60%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGL 103
DIVT+ + GLC GR+ A K+ I MKG+
Sbjct: 574 DIVTYGTLISGLCKAGRVEVASKLLRSIQMKGI 606



Score = 29.6 bits (65), Expect = 7.4
Identities = 11/33 (33%), Positives = 22/33 (66%)
Frame = +2

Query: 2 RDIVTFSASVDGLCSEGRMHEAHKMWEDINMKG 100
R+ VT++ +DGLC R+ +A ++ + + M+G
Sbjct: 503 RNSVTYNTLIDGLCKSRRVEDAAQLMDQMIMEG 535


>sp|O04491|PPR26_ARATH Putative pentatricopeptide repeat-containing
protein At1g09680 OS=Arabidopsis thaliana GN=At1g09680
PE=3 SV=1
Length = 607

Score = 35.4 bits (80), Expect = 0.13
Identities = 13/36 (36%), Positives = 25/36 (69%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D+ T+SA ++ LC E +M AH +++++ +GL+ N
Sbjct: 309 DVFTYSALINALCKENKMDGAHGLFDEMCKRGLIPN 344


>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein
At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1
Length = 598

Score = 35.0 bits (79), Expect = 0.18
Identities = 15/36 (41%), Positives = 22/36 (61%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D+VT++ V+G+C EGR+ EA K D+ G N
Sbjct: 273 DVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPN 308



Score = 29.6 bits (65), Expect = 7.4
Identities = 13/36 (36%), Positives = 21/36 (58%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D +T+S+ V GL EG++ EA K + + G+ N
Sbjct: 483 DTITYSSLVGGLSREGKVDEAIKFFHEFERMGIRPN 518


>sp|Q9SFV9|PP218_ARATH Pentatricopeptide repeat-containing protein
At3g07290, mitochondrial OS=Arabidopsis thaliana
GN=At3g07290 PE=2 SV=1
Length = 880

Score = 34.7 bits (78), Expect = 0.23
Identities = 13/29 (44%), Positives = 21/29 (72%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDIN 91
DIV+++ +DGLC EG M+ A+K+ +N
Sbjct: 440 DIVSYNVLIDGLCREGHMNTAYKLLSSMN 468


>sp|Q1PFC5|PP130_ARATH Pentatricopeptide repeat-containing protein
At1g77405 OS=Arabidopsis thaliana GN=At1g77405 PE=2 SV=1
Length = 458

Score = 34.7 bits (78), Expect = 0.23
Identities = 13/37 (35%), Positives = 24/37 (64%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMNK 115
D+VT++ +DG C R+ A +++ED+ KG + N+
Sbjct: 282 DVVTYNCLIDGCCKTNRIGRALELFEDMKTKGCVPNQ 318


>sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa
subsp. indica GN=Rf1 PE=2 SV=1
Length = 791

Score = 34.3 bits (77), Expect = 0.30
Identities = 14/33 (42%), Positives = 22/33 (66%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGL 103
D+VT+S +D LC GR EA K+++ + +GL
Sbjct: 300 DVVTYSLLMDYLCKNGRCMEARKIFDSMTKRGL 332


>sp|Q9LR67|PPR9_ARATH Pentatricopeptide repeat-containing protein
At1g03560, mitochondrial OS=Arabidopsis thaliana
GN=At1g03560 PE=2 SV=1
Length = 660

Score = 34.3 bits (77), Expect = 0.30
Identities = 15/36 (41%), Positives = 21/36 (58%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D+VT+S V+GLC GR+ EA + GL +N
Sbjct: 396 DVVTYSVVVNGLCKNGRVEEALDYFHTCRFDGLAIN 431



Score = 30.0 bits (66), Expect = 5.6
Identities = 11/28 (39%), Positives = 20/28 (71%)
Frame = +2

Query: 17 FSASVDGLCSEGRMHEAHKMWEDINMKG 100
FS + GLC EG+++E + ++E++ KG
Sbjct: 330 FSLVIGGLCKEGKLNEGYTVFENMIRKG 357



Score = 29.3 bits (64), Expect = 9.6
Identities = 11/28 (39%), Positives = 21/28 (75%)
Frame = +2

Query: 17 FSASVDGLCSEGRMHEAHKMWEDINMKG 100
+S+ +DGL GR+ EA +++E+++ KG
Sbjct: 435 YSSLIDGLGKAGRVDEAERLFEEMSEKG 462


>sp|Q0WKV3|PPR36_ARATH Pentatricopeptide repeat-containing protein
At1g12300, mitochondrial OS=Arabidopsis thaliana
GN=At1g12300 PE=2 SV=1
Length = 637

Score = 34.3 bits (77), Expect = 0.30
Identities = 13/36 (36%), Positives = 21/36 (58%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D V +S +DGLC G + A ++ ++ MKG+ N
Sbjct: 262 DAVKYSIIIDGLCKHGSLDNAFNLFNEMEMKGITTN 297


tr_hit_id A7NUP6
Definition tr|A7NUP6|A7NUP6_VITVI Chromosome chr18 scaffold_1, whole genome shotgun sequence OS=Vitis vinifera
Align length 41
Score (bit) 39.7
E-value 0.075
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912290|Adiantum capillus-veneris mRNA, clone:
YMU001_000017_C12.
(479 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NUP6|A7NUP6_VITVI Chromosome chr18 scaffold_1, whole genome... 40 0.075
tr|A5AX74|A5AX74_VITVI Putative uncharacterized protein OS=Vitis... 39 0.098
tr|Q8S6N4|Q8S6N4_ORYSJ Putative uncharacterized protein OSJNBa00... 38 0.22
tr|Q7G3D2|Q7G3D2_ORYSJ Pentatricopeptide, putative, expressed OS... 38 0.22
tr|Q0IY61|Q0IY61_ORYSJ Os10g0363500 protein OS=Oryza sativa subs... 38 0.22
tr|B4FM25|B4FM25_MAIZE Putative uncharacterized protein OS=Zea m... 38 0.22
tr|A3C405|A3C405_ORYSJ Putative uncharacterized protein OS=Oryza... 38 0.22
tr|Q8S5U6|Q8S5U6_ORYSJ Putative indole-3-acetate beta-glucosyltr... 38 0.29
tr|Q0DUV9|Q0DUV9_ORYSJ Os03g0165100 protein OS=Oryza sativa subs... 38 0.29
tr|A7PDW8|A7PDW8_VITVI Chromosome chr11 scaffold_13, whole genom... 38 0.29
tr|A2XCW4|A2XCW4_ORYSI Putative uncharacterized protein OS=Oryza... 38 0.29
tr|A2Z6E5|A2Z6E5_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.37
tr|Q5Z6A6|Q5Z6A6_ORYSJ Putative fertility restorer homologue OS=... 37 0.49
tr|Q0DBH2|Q0DBH2_ORYSJ Os06g0565000 protein OS=Oryza sativa subs... 37 0.49
tr|A7Q2Y5|A7Q2Y5_VITVI Chromosome chr12 scaffold_47, whole genom... 37 0.49
tr|A7PH00|A7PH00_VITVI Chromosome chr17 scaffold_16, whole genom... 37 0.49
tr|A5B987|A5B987_VITVI Putative uncharacterized protein OS=Vitis... 37 0.49
tr|A2YE58|A2YE58_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.49
tr|B8AWE3|B8AWE3_ORYSI Putative uncharacterized protein OS=Oryza... 37 0.64
tr|A7QB36|A7QB36_VITVI Chromosome chr5 scaffold_72, whole genome... 37 0.64
tr|A5B584|A5B584_VITVI Putative uncharacterized protein OS=Vitis... 37 0.64
tr|A3B2H8|A3B2H8_ORYSJ Putative uncharacterized protein OS=Oryza... 37 0.64
tr|Q7XJ94|Q7XJ94_RAPSA Pentatricopeptide repeat-containing prote... 36 0.83
tr|Q7X9T6|Q7X9T6_RAPSA Fertility restorer homologue A OS=Raphanu... 36 0.83
tr|Q10L04|Q10L04_ORYSJ Os03g0363700 protein OS=Oryza sativa subs... 36 0.83
tr|B8AQ91|B8AQ91_ORYSI Putative uncharacterized protein OS=Oryza... 36 0.83
tr|A7PNI8|A7PNI8_VITVI Chromosome chr1 scaffold_22, whole genome... 36 0.83
tr|A3AI78|A3AI78_ORYSJ Putative uncharacterized protein OS=Oryza... 36 0.83
tr|A4I5A7|A4I5A7_LEIIN Putative uncharacterized protein OS=Leish... 36 0.83
tr|Q6DT78|Q6DT78_ARALP AT1G03560 (Fragment) OS=Arabidopsis lyrat... 36 1.1

>tr|A7NUP6|A7NUP6_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015129001
PE=4 SV=1
Length = 524

Score = 39.7 bits (91), Expect = 0.075
Identities = 19/41 (46%), Positives = 25/41 (60%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMNKRSAR 127
D VTF+ + GLC EGR EA M E + +G+ +NK S R
Sbjct: 387 DTVTFNVILGGLCREGRFEEARGMLERLPYEGVYLNKASYR 427


>tr|A5AX74|A5AX74_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_030537 PE=4 SV=1
Length = 714

Score = 39.3 bits (90), Expect = 0.098
Identities = 19/41 (46%), Positives = 25/41 (60%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMNKRSAR 127
D VTF+ + GLC EGR EA M E + +G+ +NK S R
Sbjct: 419 DTVTFNVILGGLCREGRFEEAXGMLERLPYEGVYLNKASYR 459


>tr|Q8S6N4|Q8S6N4_ORYSJ Putative uncharacterized protein
OSJNBa0073L01.16 OS=Oryza sativa subsp. japonica
GN=OSJNBa0073L01.16 PE=4 SV=1
Length = 729

Score = 38.1 bits (87), Expect = 0.22
Identities = 14/36 (38%), Positives = 26/36 (72%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D+VT+ + GLC EGRM +A+++ ++ +KG++ N
Sbjct: 502 DVVTYDTIIHGLCKEGRMGKANQVLSEMRVKGVMPN 537


>tr|Q7G3D2|Q7G3D2_ORYSJ Pentatricopeptide, putative, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os10g21920 PE=4
SV=1
Length = 512

Score = 38.1 bits (87), Expect = 0.22
Identities = 14/36 (38%), Positives = 26/36 (72%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D+VT+ + GLC EGRM +A+++ ++ +KG++ N
Sbjct: 285 DVVTYDTIIHGLCKEGRMGKANQVLSEMRVKGVMPN 320


>tr|Q0IY61|Q0IY61_ORYSJ Os10g0363500 protein OS=Oryza sativa subsp.
japonica GN=Os10g0363500 PE=4 SV=1
Length = 375

Score = 38.1 bits (87), Expect = 0.22
Identities = 14/36 (38%), Positives = 26/36 (72%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D+VT+ + GLC EGRM +A+++ ++ +KG++ N
Sbjct: 285 DVVTYDTIIHGLCKEGRMGKANQVLSEMRVKGVMPN 320


>tr|B4FM25|B4FM25_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 338

Score = 38.1 bits (87), Expect = 0.22
Identities = 15/34 (44%), Positives = 24/34 (70%)
Frame = +2

Query: 11 VTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
VT++ V GLC EGRMH+A ++ ++ +KG+ N
Sbjct: 117 VTYNTIVHGLCKEGRMHQARRIVNEMRVKGVTPN 150


>tr|A3C405|A3C405_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_030027 PE=4 SV=1
Length = 342

Score = 38.1 bits (87), Expect = 0.22
Identities = 14/36 (38%), Positives = 26/36 (72%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
D+VT+ + GLC EGRM +A+++ ++ +KG++ N
Sbjct: 115 DVVTYDTIIHGLCKEGRMGKANQVLSEMRVKGVMPN 150


>tr|Q8S5U6|Q8S5U6_ORYSJ Putative indole-3-acetate
beta-glucosyltransferase (Putative uncharacterized
protein) (Rf1 protein, mitochondrial, putative) OS=Oryza
sativa subsp. japonica GN=OJ1123F12.4 PE=4 SV=1
Length = 648

Score = 37.7 bits (86), Expect = 0.29
Identities = 12/36 (33%), Positives = 26/36 (72%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
DIVT++ +DG+C +G + +A+ +W+D++ + + N
Sbjct: 435 DIVTYNTLIDGMCRQGDLDKANDLWDDMHSREIFPN 470


>tr|Q0DUV9|Q0DUV9_ORYSJ Os03g0165100 protein OS=Oryza sativa subsp.
japonica GN=Os03g0165100 PE=4 SV=1
Length = 695

Score = 37.7 bits (86), Expect = 0.29
Identities = 12/36 (33%), Positives = 26/36 (72%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMN 112
DIVT++ +DG+C +G + +A+ +W+D++ + + N
Sbjct: 374 DIVTYNTLIDGMCRQGDLDKANDLWDDMHSREIFPN 409


>tr|A7PDW8|A7PDW8_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016443001
PE=4 SV=1
Length = 639

Score = 37.7 bits (86), Expect = 0.29
Identities = 13/37 (35%), Positives = 25/37 (67%)
Frame = +2

Query: 5 DIVTFSASVDGLCSEGRMHEAHKMWEDINMKGLLMNK 115
DI+TF++ +DG C G++ + K+W ++N + L N+
Sbjct: 445 DIITFTSLIDGHCRTGKVERSLKLWHELNARNLSPNE 481