BP912327
Clone id YMU001_000017_G11
Library
Length 532
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000017_G11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCAAGTAGTTCTTGATTAGCCATGTTAGTAAGCGGGGTGAATTTGCTGTGTGTTTTTCTC
CTTTTGTGCGAGAAAATGGTTGTCCAGTGGAAGGCTCTCTTATCGTTTGATGTCTTTCAG
GTTGTAAAACATTTTCTTGACTCTAAGACGCGTCAAGAAGTTATGTTTGTGAATCCGAAC
AACCCCGAAAGTCTCAATCTGATGGAAGAGCTGTTTGATATGGACAATCTGAGCATGGCC
TTTGGAGGAAAACGAATGGAAGTGTATGATCATGAAAAGAACGGTAGACAAATGCTAGAG
GATGACACAAGGGCTGCTGCCTATTGGGAGCTTACTAATGGAGAGTATTGATAATTTTGA
CGGGGGGAATGCCCCTTGATGCTAACAAGGAGTAAGTATGGATCATTATTATGGCTAGTA
TGTATTGACCTCGTTGATTGTCAGGTCTTGCGAAAGAGACCTGAGAAATCACATTGATTA
CTTTTATCATGAAGTATTGGACAACTGTTTATACTACCTTAAACAATGATAT
■■Homology search results ■■ -
sp_hit_id Q54BF2
Definition sp|Q54BF2|Y2073_DICDI Putative uncharacterized transmembrane protein DDB_G0293652 OS=Dictyostelium discoideum
Align length 56
Score (bit) 35.4
E-value 0.17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912327|Adiantum capillus-veneris mRNA, clone:
YMU001_000017_G11.
(532 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54BF2|Y2073_DICDI Putative uncharacterized transmembrane pro... 35 0.17
sp|Q9UU99|YJX4_SCHPO Uncharacterized protein C23B6.04c OS=Schizo... 32 2.5
sp|P29574|YPZ3_METTF Uncharacterized protein ORF3' OS=Methanobac... 30 9.5
sp|P29573|YPV3_METTF Uncharacterized protein ORF3 OS=Methanobact... 30 9.5
sp|Q55DP9|MYBP_DICDI Myb-like protein P OS=Dictyostelium discoid... 30 9.5

>sp|Q54BF2|Y2073_DICDI Putative uncharacterized transmembrane
protein DDB_G0293652 OS=Dictyostelium discoideum
GN=DDB_G0293652 PE=4 SV=1
Length = 655

Score = 35.4 bits (80), Expect = 0.17
Identities = 16/56 (28%), Positives = 32/56 (57%)
Frame = +1

Query: 16 LAMLVSGVNLLCVFLLLCEKMVVQWKALLSFDVFQVVKHFLDSKTRQEVMFVNPNN 183
LA+ +S + ++CV LLL ++ + SFD + +++LD + + + +N NN
Sbjct: 589 LAVTISAIGIICVALLLTVVILKRRNRKSSFDYLLINQYYLDDEEEKRELLLNRNN 644


>sp|Q9UU99|YJX4_SCHPO Uncharacterized protein C23B6.04c
OS=Schizosaccharomyces pombe GN=SPCC23B6.04c PE=1 SV=1
Length = 1008

Score = 31.6 bits (70), Expect = 2.5
Identities = 18/62 (29%), Positives = 29/62 (46%)
Frame = +1

Query: 115 FQVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKNGRQM 294
F+++ F+D TR+++ F P ++ D L FGG Y HEK Q+
Sbjct: 786 FKLISPFIDPITREKLKFNEP--------LDRYVPKDQLDSNFGGSLHFEYHHEKYWPQL 837

Query: 295 LE 300
+E
Sbjct: 838 VE 839


>sp|P29574|YPZ3_METTF Uncharacterized protein ORF3'
OS=Methanobacterium thermoformicicum PE=4 SV=1
Length = 217

Score = 29.6 bits (65), Expect = 9.5
Identities = 15/40 (37%), Positives = 22/40 (55%)
Frame = +1

Query: 115 FQVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLS 234
+Q V+ +LD KT V+F+ NP E L D+ NL+
Sbjct: 41 YQDVRDYLDLKTGHRVIFLEHINPAKETAAEILADLGNLA 80


>sp|P29573|YPV3_METTF Uncharacterized protein ORF3
OS=Methanobacterium thermoformicicum PE=4 SV=1
Length = 197

Score = 29.6 bits (65), Expect = 9.5
Identities = 15/40 (37%), Positives = 22/40 (55%)
Frame = +1

Query: 115 FQVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLS 234
+Q V+ +LD KT V+F+ NP E L D+ NL+
Sbjct: 21 YQDVRDYLDLKTGHRVIFLEHVNPAKETAAEILADLGNLA 60


>sp|Q55DP9|MYBP_DICDI Myb-like protein P OS=Dictyostelium discoideum
GN=mybP PE=3 SV=1
Length = 1448

Score = 29.6 bits (65), Expect = 9.5
Identities = 14/52 (26%), Positives = 29/52 (55%)
Frame = +1

Query: 115 FQVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYD 270
F + F D++T ++++ NN ++LNL + LF+ + G++ V+D
Sbjct: 1099 FSKIASFFDNRTTEDMIVFYYNNKKTLNLKQLLFEAQSKKR---GRKSNVFD 1147


tr_hit_id A7PUV5
Definition tr|A7PUV5|A7PUV5_VITVI Chromosome chr4 scaffold_32, whole genome shotgun sequence OS=Vitis vinifera
Align length 73
Score (bit) 83.6
E-value 6.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912327|Adiantum capillus-veneris mRNA, clone:
YMU001_000017_G11.
(532 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PUV5|A7PUV5_VITVI Chromosome chr4 scaffold_32, whole genome... 84 6e-15
tr|A9NZ88|A9NZ88_PICSI Putative uncharacterized protein OS=Picea... 75 2e-12
tr|Q6J6I5|Q6J6I5_HEVBR Putative phosphoglyceride transfer family... 74 6e-12
tr|Q8GYD8|Q8GYD8_ARATH Putative uncharacterized protein At4g3664... 72 2e-11
tr|O23217|O23217_ARATH Putative uncharacterized protein C7A10.72... 72 2e-11
tr|A9NZA7|A9NZA7_PICSI Putative uncharacterized protein OS=Picea... 72 2e-11
tr|A8MQS3|A8MQS3_ARATH Uncharacterized protein At4g36640.2 OS=Ar... 72 2e-11
tr|Q9FRK8|Q9FRK8_ARATH Putative uncharacterized protein F22H5.20... 71 3e-11
tr|Q2V4C6|Q2V4C6_ARATH Uncharacterized protein At1g75170.3 OS=Ar... 71 3e-11
tr|Q2PYY3|Q2PYY3_SOLTU Transporter-like protein OS=Solanum tuber... 69 1e-10
tr|A5AXC4|A5AXC4_VITVI Putative uncharacterized protein OS=Vitis... 69 2e-10
tr|Q75GU9|Q75GU9_ORYSJ Os03g0724100 protein OS=Oryza sativa subs... 67 7e-10
tr|Q53K09|Q53K09_ORYSJ CRAL/TRIO domain, putative (Putative unch... 67 7e-10
tr|B8AQR1|B8AQR1_ORYSI Putative uncharacterized protein OS=Oryza... 67 7e-10
tr|B6T8I8|B6T8I8_MAIZE Putative uncharacterized protein OS=Zea m... 62 2e-08
tr|A9NLP4|A9NLP4_PICSI Putative uncharacterized protein OS=Picea... 62 2e-08
tr|A7Q9Y5|A7Q9Y5_VITVI Chromosome chr8 scaffold_68, whole genome... 61 3e-08
tr|A5BCR0|A5BCR0_VITVI Putative uncharacterized protein OS=Vitis... 61 3e-08
tr|B6UHW4|B6UHW4_MAIZE Putative uncharacterized protein OS=Zea m... 59 2e-07
tr|Q6Z8I8|Q6Z8I8_ORYSJ Os02g0752000 protein OS=Oryza sativa subs... 58 3e-07
tr|A2X9P2|A2X9P2_ORYSI Putative uncharacterized protein OS=Oryza... 58 3e-07
tr|Q6ATF2|Q6ATF2_ORYSJ Os05g0267100 protein OS=Oryza sativa subs... 57 5e-07
tr|B8B045|B8B045_ORYSI Putative uncharacterized protein OS=Oryza... 57 5e-07
tr|A3B204|A3B204_ORYSJ Putative uncharacterized protein OS=Oryza... 57 5e-07
tr|O22270|O22270_ARATH At4g08690 OS=Arabidopsis thaliana GN=AT4g... 57 6e-07
tr|A7NV12|A7NV12_VITVI Chromosome chr18 scaffold_1, whole genome... 57 8e-07
tr|B7FJE5|B7FJE5_MEDTR Putative uncharacterized protein OS=Medic... 55 2e-06
tr|Q9LM14|Q9LM14_ARATH F16L1.9 protein OS=Arabidopsis thaliana G... 55 2e-06
tr|Q8VY48|Q8VY48_ARATH Putative uncharacterized protein At1g2218... 55 2e-06
tr|Q5WMM0|Q5WMM0_ORYSJ Os05g0267800 protein OS=Oryza sativa subs... 55 2e-06

>tr|A7PUV5|A7PUV5_VITVI Chromosome chr4 scaffold_32, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024935001
PE=4 SV=1
Length = 290

Score = 83.6 bits (205), Expect = 6e-15
Identities = 40/73 (54%), Positives = 51/73 (69%)
Frame = +1

Query: 115 FQVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKNGRQM 294
++VVK+FLD KT Q+V FV P N ESL +M+ LFD++NL FGGK YDHE+ R M
Sbjct: 194 WKVVKYFLDPKTFQKVKFVYPKNKESLEVMKSLFDVENLPGEFGGKATLKYDHEEFSRMM 253

Query: 295 LEDDTRAAAYWEL 333
EDD + A+YW L
Sbjct: 254 AEDDVKTASYWGL 266


>tr|A9NZ88|A9NZ88_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 294

Score = 75.5 bits (184), Expect = 2e-12
Identities = 36/77 (46%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
Frame = +1

Query: 106 FDVF-QVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKN 282
F+ F ++VK+FLD KT Q+V FV + ES +L+EE+FDMD L +FGGK YDH +
Sbjct: 191 FETFWKIVKYFLDPKTFQKVKFVYSKSGESSSLLEEVFDMDKLESSFGGKNNHQYDHAEF 250

Query: 283 GRQMLEDDTRAAAYWEL 333
+ M +DD + A YW +
Sbjct: 251 SKLMQQDDVKTAEYWAM 267


>tr|Q6J6I5|Q6J6I5_HEVBR Putative phosphoglyceride transfer family
protein OS=Hevea brasiliensis PE=2 SV=1
Length = 233

Score = 73.6 bits (179), Expect = 6e-12
Identities = 37/75 (49%), Positives = 47/75 (62%), Gaps = 1/75 (1%)
Frame = +1

Query: 106 FDVF-QVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKN 282
F+ F + VK L+SKT ++V FV PNN ES +M FD+DNL FGGK YDHE+
Sbjct: 129 FEAFWKAVKCVLNSKTSEKVKFVYPNNKESEEVMRHFFDVDNLPGEFGGKATMKYDHEEF 188

Query: 283 GRQMLEDDTRAAAYW 327
R M +DD + A YW
Sbjct: 189 SRLMAQDDVKTAKYW 203


>tr|Q8GYD8|Q8GYD8_ARATH Putative uncharacterized protein
At4g36640/C7A10_720 OS=Arabidopsis thaliana
GN=At4g36640/C7A10_720 PE=2 SV=1
Length = 294

Score = 72.0 bits (175), Expect = 2e-11
Identities = 35/79 (44%), Positives = 46/79 (58%)
Frame = +1

Query: 112 VFQVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKNGRQ 291
V++ K+FLD +T ++V FV P + S LM FD++NL FGG+ YDHE RQ
Sbjct: 192 VYRAAKYFLDPRTAEKVKFVYPKDKASDELMATHFDVENLPKEFGGEATLEYDHEDFSRQ 251

Query: 292 MLEDDTRAAAYWELTNGEY 348
M EDD + A YW L Y
Sbjct: 252 MYEDDLKTAKYWGLEGKHY 270


>tr|O23217|O23217_ARATH Putative uncharacterized protein C7A10.720
(At4g36640) (Putative uncharacterized protein AT4g36640)
OS=Arabidopsis thaliana GN=C7A10.720 PE=2 SV=2
Length = 294

Score = 72.0 bits (175), Expect = 2e-11
Identities = 35/79 (44%), Positives = 46/79 (58%)
Frame = +1

Query: 112 VFQVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKNGRQ 291
V++ K+FLD +T ++V FV P + S LM FD++NL FGG+ YDHE RQ
Sbjct: 192 VYRAAKYFLDPRTAEKVKFVYPKDKASDELMTTHFDVENLPKEFGGEATLEYDHEDFSRQ 251

Query: 292 MLEDDTRAAAYWELTNGEY 348
M EDD + A YW L Y
Sbjct: 252 MYEDDLKTAKYWGLEGKHY 270


>tr|A9NZA7|A9NZA7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 290

Score = 72.0 bits (175), Expect = 2e-11
Identities = 34/75 (45%), Positives = 48/75 (64%), Gaps = 1/75 (1%)
Frame = +1

Query: 106 FDVF-QVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKN 282
F+ F ++VK+FLDSKT +V FV P N E + M+++FD D L AFGG YD+E+
Sbjct: 191 FEAFWKIVKYFLDSKTFAKVKFVYPKNEECTSFMQQVFDFDKLPTAFGGNNESEYDNEEF 250

Query: 283 GRQMLEDDTRAAAYW 327
+ M +DD + A YW
Sbjct: 251 SKLMRQDDIKTAQYW 265


>tr|A8MQS3|A8MQS3_ARATH Uncharacterized protein At4g36640.2
OS=Arabidopsis thaliana GN=At4g36640 PE=4 SV=1
Length = 234

Score = 72.0 bits (175), Expect = 2e-11
Identities = 35/79 (44%), Positives = 46/79 (58%)
Frame = +1

Query: 112 VFQVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKNGRQ 291
V++ K+FLD +T ++V FV P + S LM FD++NL FGG+ YDHE RQ
Sbjct: 132 VYRAAKYFLDPRTAEKVKFVYPKDKASDELMTTHFDVENLPKEFGGEATLEYDHEDFSRQ 191

Query: 292 MLEDDTRAAAYWELTNGEY 348
M EDD + A YW L Y
Sbjct: 192 MYEDDLKTAKYWGLEGKHY 210


>tr|Q9FRK8|Q9FRK8_ARATH Putative uncharacterized protein F22H5.20
(Putative uncharacterized protein At1g75170)
OS=Arabidopsis thaliana GN=At1g75170 PE=2 SV=1
Length = 296

Score = 71.2 bits (173), Expect = 3e-11
Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
Frame = +1

Query: 106 FDVF-QVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKN 282
F+ F ++VK+F+D+KT +V FV P N ES+ LM FD +NL FGGK + Y++E+
Sbjct: 192 FEAFWKIVKYFIDAKTFVKVKFVYPKNSESVELMSTFFDEENLPTEFGGKALLQYNYEEF 251

Query: 283 GRQMLEDDTRAAAYWEL 333
+QM +DD + A +W L
Sbjct: 252 SKQMNQDDVKTANFWGL 268


>tr|Q2V4C6|Q2V4C6_ARATH Uncharacterized protein At1g75170.3
OS=Arabidopsis thaliana GN=At1g75170 PE=4 SV=1
Length = 213

Score = 71.2 bits (173), Expect = 3e-11
Identities = 34/77 (44%), Positives = 51/77 (66%), Gaps = 1/77 (1%)
Frame = +1

Query: 106 FDVF-QVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKN 282
F+ F ++VK+F+D+KT +V FV P N ES+ LM FD +NL FGGK + Y++E+
Sbjct: 109 FEAFWKIVKYFIDAKTFVKVKFVYPKNSESVELMSTFFDEENLPTEFGGKALLQYNYEEF 168

Query: 283 GRQMLEDDTRAAAYWEL 333
+QM +DD + A +W L
Sbjct: 169 SKQMNQDDVKTANFWGL 185


>tr|Q2PYY3|Q2PYY3_SOLTU Transporter-like protein OS=Solanum
tuberosum PE=2 SV=1
Length = 286

Score = 69.3 bits (168), Expect = 1e-10
Identities = 34/74 (45%), Positives = 47/74 (63%), Gaps = 1/74 (1%)
Frame = +1

Query: 106 FDVF-QVVKHFLDSKTRQEVMFVNPNNPESLNLMEELFDMDNLSMAFGGKRMEVYDHEKN 282
F+ F ++VK+F+D KT Q+V FV P N +S LM+ FD+DNL FGG YDHE+
Sbjct: 189 FETFWRIVKYFMDPKTFQKVKFVYPKNKDSAELMKSYFDVDNLPTEFGGTATLNYDHEEF 248

Query: 283 GRQMLEDDTRAAAY 324
R M +DD +A +
Sbjct: 249 SRLMAQDDVKAQVF 262