BP912373
Clone id YMU001_000018_C12
Library
Length 584
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000018_C12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGCCAAGCAGGTTGAAACTGAGCTAAAAGAATCTGCTCCTAGTGCGGAGATTGTCTGTGT
GTATGGAGGGGTATCTTTGGATGCTCAAGTTAGGCAAGTGCAAAAAGGAGTGGATATTGC
GGTTGGAACTCCTGGACGAATGATTGATCTTCTTTACCGTGGTGCTTTGAATCTCCGAGA
AGTGCAGTATTTTGTTTTGGATGAAGCTGATCGTATGTTAGCCGTGGGATTTGAAGAGGC
TGTTGAGAAGATTTTGCAGCATCTTCCTCCTCAGAAGCAAAGCTTACTATTTTCAGCCAC
CGTGCCAGACTGGGTCAGAAAGCTTGCAGGGAAATATCTTAAAAACCACATAATAGTTGA
CCTGGTTGGTGACAATGATGAGAAGCTGGCCGAAGGAATAAAAGTGTATTCTATCTCCAC
AACACCAGGAACAAGACGGTTTATGTTGAGTGATTTGATCACAGTATATGGTAAAGGACG
CAAGGCTATTGTATTTACGCAAACAAAGAAAGAAGCTGATGAAGTCTCTTCTTTCTTATG
TTCTAAGCTGGGCTGTGAAGCACTTCATGGTGATATTTCACAAC
■■Homology search results ■■ -
sp_hit_id Q8L7S8
Definition sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3 OS=Arabidopsis thaliana
Align length 194
Score (bit) 249.0
E-value 7.0e-66
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912373|Adiantum capillus-veneris mRNA, clone:
YMU001_000018_C12.
(584 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3 OS=Ara... 249 7e-66
sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3 OS=Ory... 247 3e-65
sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53 OS=A... 228 2e-59
sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9 OS=Ara... 227 3e-59
sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53 OS=O... 221 2e-57
sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Ory... 220 4e-57
sp|Q650T9|RH7_ORYSJ DEAD-box ATP-dependent RNA helicase 7 OS=Ory... 144 4e-34
sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14 OS=O... 138 2e-32
sp|Q99MJ9|DDX50_MOUSE ATP-dependent RNA helicase DDX50 OS=Mus mu... 138 2e-32
sp|Q3B8Q1|DDX21_RAT Nucleolar RNA helicase 2 OS=Rattus norvegicu... 137 4e-32
sp|Q9JIK5|DDX21_MOUSE Nucleolar RNA helicase 2 OS=Mus musculus G... 137 4e-32
sp|Q9BQ39|DDX50_HUMAN ATP-dependent RNA helicase DDX50 OS=Homo s... 136 7e-32
sp|Q4PHU9|DBP2_USTMA ATP-dependent RNA helicase DBP2 OS=Ustilago... 134 3e-31
sp|Q41382|RH7_SPIOL DEAD-box ATP-dependent RNA helicase 7 OS=Spi... 132 1e-30
sp|Q9NR30|DDX21_HUMAN Nucleolar RNA helicase 2 OS=Homo sapiens G... 132 1e-30
sp|P46942|DB10_NICSY ATP-dependent RNA helicase-like protein DB1... 132 1e-30
sp|Q5B0J9|DBP2_EMENI ATP-dependent RNA helicase dbp2 OS=Emericel... 132 2e-30
sp|Q6C4D4|DBP2_YARLI ATP-dependent RNA helicase DBP2 OS=Yarrowia... 131 2e-30
sp|A1DGZ7|DBP2_NEOFI ATP-dependent RNA helicase dbp2 OS=Neosarto... 130 4e-30
sp|Q8H136|RH14_ARATH DEAD-box ATP-dependent RNA helicase 14 OS=A... 130 5e-30
sp|Q5JKF2|RH40_ORYSJ DEAD-box ATP-dependent RNA helicase 40 OS=O... 130 6e-30
sp|Q9LYJ9|RH46_ARATH DEAD-box ATP-dependent RNA helicase 46 OS=A... 129 8e-30
sp|Q2U070|DBP2_ASPOR ATP-dependent RNA helicase dbp2 OS=Aspergil... 129 1e-29
sp|A1C6C4|DBP2_ASPCL ATP-dependent RNA helicase dbp2 OS=Aspergil... 128 2e-29
sp|A2QC74|DBP2_ASPNC ATP-dependent RNA helicase dbp2 OS=Aspergil... 127 4e-29
sp|Q39189|RH7_ARATH DEAD-box ATP-dependent RNA helicase 7 OS=Ara... 127 5e-29
sp|Q4IF76|DBP2_GIBZE ATP-dependent RNA helicase DBP2 OS=Gibberel... 126 7e-29
sp|Q86TM3|DDX53_HUMAN Probable ATP-dependent RNA helicase DDX53 ... 126 9e-29
sp|Q4X195|DBP2_ASPFU ATP-dependent RNA helicase dbp2 OS=Aspergil... 126 9e-29
sp|Q54CE0|DDX17_DICDI Probable ATP-dependent RNA helicase ddx17 ... 125 1e-28

>sp|Q8L7S8|RH3_ARATH DEAD-box ATP-dependent RNA helicase 3
OS=Arabidopsis thaliana GN=RH3 PE=2 SV=2
Length = 748

Score = 249 bits (636), Expect = 7e-66
Identities = 127/194 (65%), Positives = 155/194 (79%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E+KESAP VCVYGGVS Q + +GVD+ VGTPGR+IDL+ +L L E
Sbjct: 193 AKQVEKEIKESAPYLSTVCVYGGVSYTIQQSALTRGVDVVVGTPGRIIDLIEGRSLKLGE 252

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
V+Y VLDEAD+MLAVGFEEAVE IL++LP ++QS+LFSAT+P WV+KLA KYL N + +D
Sbjct: 253 VEYLVLDEADQMLAVGFEEAVESILENLPTKRQSMLFSATMPTWVKKLARKYLDNPLNID 312

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD DEKLAEGIK+Y+I+TT ++R +LSDLITVY KG K IVFTQTK++ADEVS L
Sbjct: 313 LVGDQDEKLAEGIKLYAIATTSTSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALS 372

Query: 542 SKLGCEALHGDISQ 583
+ + EALHGDISQ
Sbjct: 373 NSIATEALHGDISQ 386


>sp|Q0DM51|RH3_ORYSJ DEAD-box ATP-dependent RNA helicase 3 OS=Oryza
sativa subsp. japonica GN=Os03g0827700 PE=2 SV=2
Length = 758

Score = 247 bits (631), Expect = 3e-65
Identities = 124/194 (63%), Positives = 153/194 (78%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E+KESAP VCVYGGVS + Q + +GVD+ VGTPGR+IDL+ G+L L E
Sbjct: 193 AKQVEKEIKESAPKLSTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGE 252

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
V+Y VLDEAD+MLAVGFEE VE ILQ LP ++QS+LFSAT+P WV+KL+ +YL N + +D
Sbjct: 253 VKYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPGWVKKLSRRYLNNPLTID 312

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD DEKLAEGIK+Y+I T ++R +LSDLITVY KG K IVFT+TK++ADEVS L
Sbjct: 313 LVGDQDEKLAEGIKLYAIPLTSTSKRTVLSDLITVYAKGGKTIVFTKTKRDADEVSLALT 372

Query: 542 SKLGCEALHGDISQ 583
+ + EALHGDISQ
Sbjct: 373 NSIASEALHGDISQ 386


>sp|Q9LUW5|RH53_ARATH DEAD-box ATP-dependent RNA helicase 53
OS=Arabidopsis thaliana GN=RH53 PE=2 SV=1
Length = 616

Score = 228 bits (581), Expect = 2e-59
Identities = 113/194 (58%), Positives = 144/194 (74%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
A+QVE E +ESAPS + +C+YGG + Q+RQ+ GVD+AVGTPGR+IDL+ RGALNL E
Sbjct: 191 ARQVEKEFRESAPSLDTICLYGGTPIGQQMRQLDYGVDVAVGTPGRVIDLMKRGALNLSE 250

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
VQ+ VLDEAD+ML VGF E VE IL+ LP ++QS++FSAT+P W+R L KYL N + VD
Sbjct: 251 VQFVVLDEADQMLQVGFAEDVEIILEKLPEKRQSMMFSATMPSWIRSLTKKYLNNPLTVD 310

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD+D+KLA+GI YSI R ++ L+T + KG K IVFTQTK++AD +S L
Sbjct: 311 LVGDSDQKLADGITTYSIIADSYGRASIIGPLVTEHAKGGKCIVFTQTKRDADRLSYALA 370

Query: 542 SKLGCEALHGDISQ 583
CEALHGDISQ
Sbjct: 371 RSFKCEALHGDISQ 384


>sp|Q9LUW6|RH9_ARATH DEAD-box ATP-dependent RNA helicase 9
OS=Arabidopsis thaliana GN=RH9 PE=2 SV=1
Length = 610

Score = 227 bits (579), Expect = 3e-59
Identities = 110/194 (56%), Positives = 146/194 (75%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
A+QVE E +ESAPS + +C+YGG + Q+R++ G+D+AVGTPGR+IDL+ RGALNL E
Sbjct: 203 ARQVEKEFRESAPSLDTICLYGGTPIGQQMRELNYGIDVAVGTPGRIIDLMKRGALNLSE 262

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
VQ+ VLDEAD+ML VGF E VE ILQ LP ++QS++FSAT+P W+R L KYL N + +D
Sbjct: 263 VQFVVLDEADQMLQVGFAEDVEIILQKLPAKRQSMMFSATMPSWIRSLTKKYLNNPLTID 322

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD+D+KLA+GI +YSI+ R ++ L+ +GKG K IVFTQTK++AD ++ L
Sbjct: 323 LVGDSDQKLADGITMYSIAADSYGRASIIGPLVKEHGKGGKCIVFTQTKRDADRLAFGLA 382

Query: 542 SKLGCEALHGDISQ 583
CEALHGDISQ
Sbjct: 383 KSYKCEALHGDISQ 396


>sp|Q0D8N0|RH53_ORYSJ DEAD-box ATP-dependent RNA helicase 53
OS=Oryza sativa subsp. japonica GN=Os07g0143700 PE=2
SV=2
Length = 602

Score = 221 bits (563), Expect = 2e-57
Identities = 111/194 (57%), Positives = 145/194 (74%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
A+QVE E KESAP + +CVYGGV + Q+R + GVD+ VGTPGR+IDLL RG LNL E
Sbjct: 171 ARQVEKEFKESAP-LDSLCVYGGVPISHQMRALNYGVDVVVGTPGRIIDLLRRGVLNLSE 229

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
+Q+ VLDEAD+MLAVGF+E VE I+++LP +QS+LFSAT+P W+RK+ KYLK+ II+D
Sbjct: 230 IQFVVLDEADQMLAVGFDEDVEVIMENLPQNRQSMLFSATMPSWIRKITSKYLKDPIIID 289

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD D+KL EGI +YSI++ + +L LI + G K IVFTQTK+EAD ++ +
Sbjct: 290 LVGDEDQKLPEGISLYSIASEHYGKPSILGPLIKEHANGGKCIVFTQTKREADRLAYAMG 349

Query: 542 SKLGCEALHGDISQ 583
C+ALHGDISQ
Sbjct: 350 RSYACQALHGDISQ 363


>sp|Q0ILZ4|RH9_ORYSJ DEAD-box ATP-dependent RNA helicase 9 OS=Oryza
sativa subsp. japonica GN=Os12g0611200 PE=3 SV=1
Length = 628

Score = 220 bits (561), Expect = 4e-57
Identities = 106/194 (54%), Positives = 148/194 (76%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E +S+ + E +CVYGG + Q+RQ+ GVD+ +GTPGR+IDLL RGALNL E
Sbjct: 185 AKQVEREFSDSS-NVETICVYGGTPISQQIRQLNYGVDVVIGTPGRVIDLLKRGALNLSE 243

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
V++ VLDEAD+ML+VGF+E VE IL +PP++Q+L+FSAT+P W+++L KYLKN + +D
Sbjct: 244 VRFVVLDEADQMLSVGFDEDVETILDRVPPKRQTLMFSATMPTWIQRLTQKYLKNPVTID 303

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVG++D+KLAEGI +YSI++ + +L +LI + KG K IVFTQTK++AD +S +
Sbjct: 304 LVGEDDQKLAEGISLYSIASEGHAKPAVLGELIKEHAKGGKCIVFTQTKRDADRLSYTMG 363

Query: 542 SKLGCEALHGDISQ 583
C+ALHGDI+Q
Sbjct: 364 RSFQCQALHGDITQ 377


>sp|Q650T9|RH7_ORYSJ DEAD-box ATP-dependent RNA helicase 7 OS=Oryza
sativa subsp. japonica GN=Os09g0520700 PE=2 SV=1
Length = 696

Score = 144 bits (362), Expect = 4e-34
Identities = 81/199 (40%), Positives = 123/199 (61%), Gaps = 5/199 (2%)
Frame = +2

Query: 2 AKQVETELKESAPSAEI--VCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNL 175
AKQV T+ + + CVYGG +Q ++KGVDI VGTPGR+ D + +G LN
Sbjct: 206 AKQVHTDFAFYGATFGLSACCVYGGSDYRSQEMAIRKGVDIVVGTPGRVKDFVEKGTLNF 265

Query: 176 REVQYFVLDEADRMLAVGFEEAVEKILQHLP--PQKQSLLFSATVPDWVRKLAGKYLKN- 346
R +++ VLDEAD ML +GF + VE IL + + Q+LLFSAT+P+WV+KL+ ++LK+
Sbjct: 266 RSLKFRVLDEADEMLNMGFVDDVELILGKVEDVTKVQTLLFSATIPEWVKKLSLRFLKSG 325

Query: 347 HIIVDLVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEV 526
VDLVGD K + ++ ++ R ++ D+I Y +G + I+FT+TK+ A ++
Sbjct: 326 KKTVDLVGDEKLKASASVRHLALPCNRAARAQVIPDIIRCYSRGGRTIIFTETKESASDL 385

Query: 527 SSFLCSKLGCEALHGDISQ 583
S + G ALHGD++Q
Sbjct: 386 SGLIA---GSRALHGDVAQ 401


>sp|Q5VQL1|RH14_ORYSJ DEAD-box ATP-dependent RNA helicase 14
OS=Oryza sativa subsp. japonica GN=Os01g0172200 PE=2
SV=1
Length = 708

Score = 138 bits (348), Expect = 2e-32
Identities = 77/197 (39%), Positives = 119/197 (60%), Gaps = 3/197 (1%)
Frame = +2

Query: 2 AKQVETELKESAPSAEI--VCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNL 175
A Q++ E K+ S+ I VC+YGG Q+R +++G DI V TPGR+ D+L ++L
Sbjct: 265 ATQIQDEAKKFGRSSRISSVCLYGGAPKGPQLRDLERGADIVVATPGRLNDILEMRRVSL 324

Query: 176 REVQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHII 355
+V Y VLDEADRML +GFE + KI++ + P++Q+L+F+AT P VRK+A L N +
Sbjct: 325 HQVSYLVLDEADRMLDMGFEPQIRKIVKQVQPKRQTLMFTATWPKEVRKIASDLLSNPVQ 384

Query: 356 VDLVGDNDEKLA-EGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSS 532
V+ +G+ D+ +A + I Y TP + L ++ G K I+F TK+ D+++
Sbjct: 385 VN-IGNTDQLVANKSITQYVDVITPPEKSRRLDQILRSQEPGSKIIIFCSTKRMCDQLAR 443

Query: 533 FLCSKLGCEALHGDISQ 583
L + G A+HGD SQ
Sbjct: 444 NLARQYGASAIHGDKSQ 460


>sp|Q99MJ9|DDX50_MOUSE ATP-dependent RNA helicase DDX50 OS=Mus
musculus GN=Ddx50 PE=2 SV=1
Length = 734

Score = 138 bits (348), Expect = 2e-32
Identities = 80/201 (39%), Positives = 117/201 (58%), Gaps = 7/201 (3%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
A QV + K+ + C YGG S +Q+ Q++ G+DI VGTPGR+ D L G L+L +
Sbjct: 221 ANQVAKDFKDITRKLSVACFYGGTSYQSQINQIRNGIDILVGTPGRIKDHLQSGRLDLSK 280

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQH-----LPPQKQSLLFSATVPDWVRKLAGKYLKN 346
+++ VLDE D+ML +GF E VE I+ Q+LLFSAT P WV K+A KY+K+
Sbjct: 281 LRHVVLDEVDQMLDLGFAEQVEDIIHESYKTDSEDNPQTLLFSATCPQWVYKVAKKYMKS 340

Query: 347 -HIIVDLVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVY-GKGRKAIVFTQTKKEAD 520
+ VDLVG +K A ++ +I R ++ D++ VY G +AI+F +TKK
Sbjct: 341 RYEQVDLVGKMTQKAATTVEHLAIQCHWSQRPAVIGDVLQVYSGSEGRAIIFCETKKNVT 400

Query: 521 EVSSFLCSKLGCEALHGDISQ 583
E++ K + LHGDI+Q
Sbjct: 401 EMAMNPHIKQNAQCLHGDIAQ 421


>sp|Q3B8Q1|DDX21_RAT Nucleolar RNA helicase 2 OS=Rattus norvegicus
GN=Ddx21 PE=2 SV=1
Length = 782

Score = 137 bits (345), Expect = 4e-32
Identities = 78/201 (38%), Positives = 117/201 (58%), Gaps = 7/201 (3%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
A QV + + + C YGG Q+ +++ G+DI VGTPGR+ D L G L+L +
Sbjct: 269 ANQVSKDFSDITKKLSVACFYGGTPYGGQIERMRSGIDILVGTPGRIKDHLQNGKLDLTK 328

Query: 182 VQYFVLDEADRMLAVGFEEAVEKIL-----QHLPPQKQSLLFSATVPDWVRKLAGKYLKN 346
+++ VLDE D+ML +GF + VE+IL + Q+LLFSAT P WV +A KY+K+
Sbjct: 329 LKHVVLDEVDQMLDMGFADQVEEILCVAYKKDSEDNPQTLLFSATCPHWVFNVAKKYMKS 388

Query: 347 -HIIVDLVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVY-GKGRKAIVFTQTKKEAD 520
+ VDL+G +K A ++ +I R ++ D+I VY G + I+F +TKK+A
Sbjct: 389 TYEQVDLIGKKTQKAAITVEHLAIKCHWTERAAVIGDVIRVYSGHQGRTIIFCETKKDAQ 448

Query: 521 EVSSFLCSKLGCEALHGDISQ 583
E+S C K ++LHGDI Q
Sbjct: 449 ELSQNTCIKQDAQSLHGDIPQ 469


tr_hit_id A9RFR6
Definition tr|A9RFR6|A9RFR6_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 194
Score (bit) 250.0
E-value 4.0e-65
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912373|Adiantum capillus-veneris mRNA, clone:
YMU001_000018_C12.
(584 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RFR6|A9RFR6_PHYPA Predicted protein OS=Physcomitrella paten... 250 4e-65
tr|A9S7H7|A9S7H7_PHYPA Predicted protein OS=Physcomitrella paten... 248 1e-64
tr|B6SSK6|B6SSK6_MAIZE Nucleolar RNA helicase 2 OS=Zea mays PE=2... 248 2e-64
tr|B4FA24|B4FA24_MAIZE Putative uncharacterized protein OS=Zea m... 248 2e-64
tr|B8AMQ6|B8AMQ6_ORYSI Putative uncharacterized protein OS=Oryza... 247 3e-64
tr|B7EBF8|B7EBF8_ORYSJ cDNA clone:J013043E01, full insert sequen... 247 3e-64
tr|Q2HUZ8|Q2HUZ8_MEDTR Helicase, C-terminal; Zinc finger, CCHC-t... 245 1e-63
tr|A7PRF1|A7PRF1_VITVI Chromosome chr14 scaffold_27, whole genom... 245 1e-63
tr|Q6L724|Q6L724_HORVU ATP-dependent RNA helicase OS=Hordeum vul... 244 3e-63
tr|A9T4H8|A9T4H8_PHYPA Predicted protein (Fragment) OS=Physcomit... 241 2e-62
tr|B8LKW8|B8LKW8_PICSI Putative uncharacterized protein OS=Picea... 236 5e-61
tr|A9RFT8|A9RFT8_PHYPA Predicted protein (Fragment) OS=Physcomit... 235 1e-60
tr|A5AH66|A5AH66_VITVI Putative uncharacterized protein OS=Vitis... 229 7e-59
tr|A7PJZ6|A7PJZ6_VITVI Chromosome chr12 scaffold_18, whole genom... 229 1e-58
tr|A5C4J0|A5C4J0_VITVI Putative uncharacterized protein OS=Vitis... 222 1e-56
tr|A2ZMM6|A2ZMM6_ORYSI Putative uncharacterized protein OS=Oryza... 222 1e-56
tr|B8B7E6|B8B7E6_ORYSI Putative uncharacterized protein OS=Oryza... 221 2e-56
tr|A3CJC5|A3CJC5_ORYSJ Putative uncharacterized protein OS=Oryza... 220 4e-56
tr|B6SV06|B6SV06_MAIZE Nucleolar RNA helicase 2 OS=Zea mays PE=2... 216 1e-54
tr|A3BGI4|A3BGI4_ORYSJ Putative uncharacterized protein OS=Oryza... 212 1e-53
tr|Q019E9|Q019E9_OSTTA ATP-dependent RNA helicase (ISS) OS=Ostre... 202 1e-50
tr|A3APA5|A3APA5_ORYSJ Putative uncharacterized protein OS=Oryza... 199 1e-49
tr|Q2PEW4|Q2PEW4_TRIPR Putative uncharacterized protein (Fragmen... 196 8e-49
tr|Q1J0S9|Q1J0S9_DEIGD DEAD/DEAH box helicase-like protein OS=De... 175 2e-42
tr|A8J6S5|A8J6S5_CHLRE Predicted protein (Fragment) OS=Chlamydom... 166 7e-40
tr|A8JGT1|A8JGT1_CHLRE RNA helicase OS=Chlamydomonas reinhardtii... 160 4e-38
tr|A9PJW0|A9PJW0_POPJC Putative uncharacterized protein OS=Popul... 158 2e-37
tr|A4RXF6|A4RXF6_OSTLU Predicted protein OS=Ostreococcus lucimar... 155 1e-36
tr|B7A6V9|B7A6V9_THEAQ DEAD/DEAH box helicase domain protein OS=... 155 2e-36
tr|A9S0Z8|A9S0Z8_PHYPA Predicted protein OS=Physcomitrella paten... 149 9e-35

>tr|A9RFR6|A9RFR6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_113584 PE=4 SV=1
Length = 793

Score = 250 bits (639), Expect = 4e-65
Identities = 120/194 (61%), Positives = 160/194 (82%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E ESAP +CVYGGV++ +Q R + +GVDIAVGTPGR+IDL+ RG+L L+E
Sbjct: 228 AKQVEREFMESAPMLSTICVYGGVAISSQQRLLTRGVDIAVGTPGRIIDLINRGSLRLQE 287

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
V++ VLDEAD+MLAVGFEE VE+IL+ +P Q+QS+LFSAT+P WV+KL+ KYL + + +D
Sbjct: 288 VRFLVLDEADQMLAVGFEEDVEQILEQMPNQRQSMLFSATMPTWVKKLSRKYLHDALTID 347

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVG++DEKLA+ IK+Y+++T P +R +L+DLI VYGKG K IVFTQTK++AD+V++ +
Sbjct: 348 LVGESDEKLADRIKLYAVATVPQAKRSILNDLIAVYGKGGKTIVFTQTKRDADDVATAMA 407

Query: 542 SKLGCEALHGDISQ 583
LGCEALHGDISQ
Sbjct: 408 RTLGCEALHGDISQ 421


>tr|A9S7H7|A9S7H7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_125455 PE=4 SV=1
Length = 689

Score = 248 bits (634), Expect = 1e-64
Identities = 121/194 (62%), Positives = 159/194 (81%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E ESAP VCVYGGVS+ Q RQ+Q+GVD+AVGTPGR+IDL+ R +L+LR+
Sbjct: 138 AKQVEREFMESAPMLSTVCVYGGVSITTQQRQLQRGVDVAVGTPGRIIDLIERRSLSLRD 197

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
V Y VLDEAD+MLAVGFEE VE+IL+ +P ++QS+LFSAT+P+WV+KL+ KYLK+ + +D
Sbjct: 198 VSYLVLDEADQMLAVGFEEDVERILEQMPEERQSMLFSATMPNWVKKLSKKYLKSPLTID 257

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD++EKLAEGIK+ ++ P +R +L+DLI+V+G K IVFTQTK++AD+V+S L
Sbjct: 258 LVGDSNEKLAEGIKMLAVCIPPAAKRTVLNDLISVHGSVGKTIVFTQTKRDADDVASVLG 317

Query: 542 SKLGCEALHGDISQ 583
LGCEALHGDI+Q
Sbjct: 318 RTLGCEALHGDITQ 331


>tr|B6SSK6|B6SSK6_MAIZE Nucleolar RNA helicase 2 OS=Zea mays PE=2
SV=1
Length = 744

Score = 248 bits (633), Expect = 2e-64
Identities = 126/194 (64%), Positives = 152/194 (78%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E+KESAP VCVYGGVS + Q + +GVD+ VGTPGR+IDL+ G+L L E
Sbjct: 177 AKQVEKEIKESAPKLGTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGE 236

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
VQY VLDEAD+MLAVGFEE VE ILQ LP +QS+LFSAT+P WV+KL+ +YL N + +D
Sbjct: 237 VQYLVLDEADQMLAVGFEEDVETILQQLPAGRQSMLFSATMPSWVKKLSRRYLNNPLTID 296

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD DEKLAEGIK+Y+I T ++R +LSDLITVY KG K IVFT+TKK+ADEVS L
Sbjct: 297 LVGDQDEKLAEGIKLYAIPLTATSKRTVLSDLITVYAKGGKTIVFTRTKKDADEVSLALT 356

Query: 542 SKLGCEALHGDISQ 583
+ + EALHGDISQ
Sbjct: 357 NSIASEALHGDISQ 370


>tr|B4FA24|B4FA24_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 598

Score = 248 bits (633), Expect = 2e-64
Identities = 126/194 (64%), Positives = 152/194 (78%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E+KESAP VCVYGGVS + Q + +GVD+ VGTPGR+IDL+ G+L L E
Sbjct: 32 AKQVEKEIKESAPKLGTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGE 91

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
VQY VLDEAD+MLAVGFEE VE ILQ LP +QS+LFSAT+P WV+KL+ +YL N + +D
Sbjct: 92 VQYLVLDEADQMLAVGFEEDVETILQQLPAGRQSMLFSATMPSWVKKLSRRYLNNPLTID 151

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD DEKLAEGIK+Y+I T ++R +LSDLITVY KG K IVFT+TKK+ADEVS L
Sbjct: 152 LVGDQDEKLAEGIKLYAIPLTTTSKRTVLSDLITVYAKGGKTIVFTRTKKDADEVSLALT 211

Query: 542 SKLGCEALHGDISQ 583
+ + EALHGDISQ
Sbjct: 212 NSIASEALHGDISQ 225


>tr|B8AMQ6|B8AMQ6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_14162 PE=4 SV=1
Length = 779

Score = 247 bits (631), Expect = 3e-64
Identities = 124/194 (63%), Positives = 153/194 (78%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E+KESAP VCVYGGVS + Q + +GVD+ VGTPGR+IDL+ G+L L E
Sbjct: 214 AKQVEKEIKESAPKLSTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGE 273

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
V+Y VLDEAD+MLAVGFEE VE ILQ LP ++QS+LFSAT+P WV+KL+ +YL N + +D
Sbjct: 274 VKYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPGWVKKLSRRYLNNPLTID 333

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD DEKLAEGIK+Y+I T ++R +LSDLITVY KG K IVFT+TK++ADEVS L
Sbjct: 334 LVGDQDEKLAEGIKLYAIPLTSTSKRTVLSDLITVYAKGGKTIVFTKTKRDADEVSLALT 393

Query: 542 SKLGCEALHGDISQ 583
+ + EALHGDISQ
Sbjct: 394 NSIASEALHGDISQ 407


>tr|B7EBF8|B7EBF8_ORYSJ cDNA clone:J013043E01, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 597

Score = 247 bits (631), Expect = 3e-64
Identities = 124/194 (63%), Positives = 153/194 (78%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E+KESAP VCVYGGVS + Q + +GVD+ VGTPGR+IDL+ G+L L E
Sbjct: 32 AKQVEKEIKESAPKLSTVCVYGGVSYNVQQNALSRGVDVVVGTPGRIIDLINGGSLQLGE 91

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
V+Y VLDEAD+MLAVGFEE VE ILQ LP ++QS+LFSAT+P WV+KL+ +YL N + +D
Sbjct: 92 VKYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPGWVKKLSRRYLNNPLTID 151

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD DEKLAEGIK+Y+I T ++R +LSDLITVY KG K IVFT+TK++ADEVS L
Sbjct: 152 LVGDQDEKLAEGIKLYAIPLTSTSKRTVLSDLITVYAKGGKTIVFTKTKRDADEVSLALT 211

Query: 542 SKLGCEALHGDISQ 583
+ + EALHGDISQ
Sbjct: 212 NSIASEALHGDISQ 225


>tr|Q2HUZ8|Q2HUZ8_MEDTR Helicase, C-terminal; Zinc finger,
CCHC-type; GUCT OS=Medicago truncatula
GN=MtrDRAFT_AC149038g14v2 PE=4 SV=1
Length = 753

Score = 245 bits (625), Expect = 1e-63
Identities = 124/194 (63%), Positives = 152/194 (78%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E+KESAP + VC+YGGVS Q + +GVD+ VGTPGR+IDL+ L L E
Sbjct: 197 AKQVEKEIKESAPYLKTVCIYGGVSYVTQQSALSRGVDVVVGTPGRLIDLINGNTLKLSE 256

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
V+Y VLDEAD+MLAVGFEE VE IL+ LP ++QS+LFSAT+P WV+KLA KYL N + +D
Sbjct: 257 VEYLVLDEADQMLAVGFEEDVEVILEKLPAKRQSMLFSATMPSWVKKLARKYLNNPLTID 316

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD +EKLAEGIK+Y+IS T ++R +LSDLITVY KG K IVFTQTK++ADEVS L
Sbjct: 317 LVGDEEEKLAEGIKLYAISATSTSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSLALT 376

Query: 542 SKLGCEALHGDISQ 583
+ + EALHGDISQ
Sbjct: 377 NSITSEALHGDISQ 390


>tr|A7PRF1|A7PRF1_VITVI Chromosome chr14 scaffold_27, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00022481001
PE=4 SV=1
Length = 762

Score = 245 bits (625), Expect = 1e-63
Identities = 126/194 (64%), Positives = 152/194 (78%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E+KESAP VCVYGGVS Q + +GVD+ VGTPGR+IDL+ +L L E
Sbjct: 200 AKQVEKEIKESAPYLSTVCVYGGVSYITQQNALSRGVDVVVGTPGRIIDLIKGNSLKLGE 259

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
VQ VLDEAD+MLAVGFEE VE IL+ LP ++QS+LFSAT+P WV+KLA KYL N + +D
Sbjct: 260 VQNLVLDEADQMLAVGFEEDVEVILEKLPSERQSMLFSATMPAWVKKLARKYLDNPLTID 319

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD+DEKLAEGIK+Y+I TT ++R +LSDLITVY KG K IVFTQTK++ADEVS L
Sbjct: 320 LVGDHDEKLAEGIKLYAIPTTATSKRTILSDLITVYAKGGKTIVFTQTKRDADEVSMALT 379

Query: 542 SKLGCEALHGDISQ 583
+ + EALHGDISQ
Sbjct: 380 NSIASEALHGDISQ 393


>tr|Q6L724|Q6L724_HORVU ATP-dependent RNA helicase OS=Hordeum
vulgare GN=HVD1 PE=2 SV=1
Length = 764

Score = 244 bits (623), Expect = 3e-63
Identities = 122/194 (62%), Positives = 152/194 (78%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E+ ESAP VCVYGGVS + Q + +GVD+ VGTPGR+IDL+ G+L L E
Sbjct: 180 AKQVEKEIMESAPKLSTVCVYGGVSYNTQQNALSRGVDVVVGTPGRLIDLINGGSLQLGE 239

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
V+Y VLDEAD+MLAVGFEE VE ILQ LP ++QS+LFSAT+P WV+KL+ +YL N + +D
Sbjct: 240 VRYLVLDEADQMLAVGFEEDVETILQQLPAERQSMLFSATMPSWVKKLSRRYLNNPLTID 299

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD DEKLAEGIK+++I T ++R +LSDLITVY KG K IVFT+TK++ADEVS L
Sbjct: 300 LVGDQDEKLAEGIKLFAIPLTTTSKRTILSDLITVYAKGGKTIVFTRTKRDADEVSLALT 359

Query: 542 SKLGCEALHGDISQ 583
+ + EALHGDISQ
Sbjct: 360 TSIASEALHGDISQ 373


>tr|A9T4H8|A9T4H8_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_30666 PE=4 SV=1
Length = 619

Score = 241 bits (615), Expect = 2e-62
Identities = 120/194 (61%), Positives = 153/194 (78%)
Frame = +2

Query: 2 AKQVETELKESAPSAEIVCVYGGVSLDAQVRQVQKGVDIAVGTPGRMIDLLYRGALNLRE 181
AKQVE E ESAP VCVYGGV + Q RQ+++GVDIAVGTPGR+IDL+ RG+L L++
Sbjct: 93 AKQVEREFMESAPMLSTVCVYGGVPISMQQRQLERGVDIAVGTPGRIIDLIDRGSLKLKD 152

Query: 182 VQYFVLDEADRMLAVGFEEAVEKILQHLPPQKQSLLFSATVPDWVRKLAGKYLKNHIIVD 361
V + VLDEAD+MLAVGFEE VE+ILQ LP Q+QS+LFSAT+P WV++L+ KYL + +D
Sbjct: 153 VHFLVLDEADQMLAVGFEEDVERILQQLPKQRQSMLFSATMPKWVKELSRKYLNKPLTID 212

Query: 362 LVGDNDEKLAEGIKVYSISTTPGTRRFMLSDLITVYGKGRKAIVFTQTKKEADEVSSFLC 541
LVGD+DEKLA+GIK +I +R +LSDLITV+GKG K IVFTQTK++AD+V+ +
Sbjct: 213 LVGDSDEKLADGIKNLAIQLPASAKRSILSDLITVHGKGGKTIVFTQTKRDADDVAMAMG 272

Query: 542 SKLGCEALHGDISQ 583
+ + C ALHGDISQ
Sbjct: 273 NLVSCGALHGDISQ 286