BP912384
Clone id YMU001_000018_D11
Library
Length 535
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000018_D11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGAGAAACCTGTGTTGCTATCCATACTGATGCTAATCAGGTGCCACAATGGTATAATGAC
TGTCAACAAGCGTCTCTGCATCCCATAGAAAACTACCAAAAGCAACTGCTTCTAGAACTA
ACCTTCTGAGCCCTGCAAGACTTAGCATCATTGCCACCTCTCTTCCAGTTACCTCTGAAA
CGTCAAAAAAATTTGAAGTTCCTTGGGCCTCCGCCAAAAGGGGGGGGGGGNNAAAAGGGA
ATGGCCCTTTGGCCAGGTGTGTCTTTCAATGATGCAAGCACTTTCAATCGACCGGACTGT
CGCACAACGATACAATGTATCAGCCTCAGAAGAGAGCAAATAATTTCGCAGTAAATTTTT
GATCGACCGCTGCTTGAAAAGCCTACATCCTGTTCCAAATTTTCCAAATTACCAAACCCC
AAAATTGCTGAAAGAGTGGCTAACATTTCTGTCGCAAAGGTATCACGTTTATCGTCCTGG
AACTTCGCGTCGCTTGCTTGACGCTTTCTTCTATCAGATTCCGGTGCAGATGGTG
■■Homology search results ■■ -
sp_hit_id A5GUL0
Definition sp|A5GUL0|SYE_SYNR3 Glutamyl-tRNA synthetase OS=Synechococcus sp. (strain RCC307)
Align length 63
Score (bit) 33.9
E-value 0.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912384|Adiantum capillus-veneris mRNA, clone:
YMU001_000018_D11.
(535 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|A5GUL0|SYE_SYNR3 Glutamyl-tRNA synthetase OS=Synechococcus sp... 34 0.50
sp|Q0P427|CG047_DANRE UPF0683 protein C7orf47 homolog OS=Danio r... 32 2.5
sp|Q9XZ08|EXT3_DROME Exostosin-3 OS=Drosophila melanogaster GN=b... 31 4.3
sp|Q6CUC6|TAF4_KLULA Transcription initiation factor TFIID subun... 30 5.6
sp|Q2EEW9|RPOC1_HELSJ DNA-directed RNA polymerase subunit gamma ... 30 9.7
sp|Q9UV10|HET6_NEUCR Heterokaryon incompatibility protein 6, OR ... 30 9.7

>sp|A5GUL0|SYE_SYNR3 Glutamyl-tRNA synthetase OS=Synechococcus sp.
(strain RCC307) GN=gltX PE=3 SV=1
Length = 475

Score = 33.9 bits (76), Expect = 0.50
Identities = 21/63 (33%), Positives = 33/63 (52%)
Frame = -3

Query: 515 DRRKRQASDAKFQDDKRDTFATEMLATLSAILGFGNLENLEQDVGFSSSGRSKIYCEIIC 336
D ++ + A+F DK + ++L L A L L Q+ GF +SGRS+ + E +C
Sbjct: 299 DFQRVNKAGARFDWDKLNWLNGQVLHELGAAELNRKLTPLWQEAGFETSGRSQAWLEQLC 358

Query: 335 SLL 327
LL
Sbjct: 359 ELL 361


>sp|Q0P427|CG047_DANRE UPF0683 protein C7orf47 homolog OS=Danio
rerio GN=zgc:153512 PE=2 SV=1
Length = 251

Score = 31.6 bits (70), Expect = 2.5
Identities = 17/34 (50%), Positives = 23/34 (67%), Gaps = 2/34 (5%)
Frame = +1

Query: 319 ISLRREQIISQ*IFDRPLLEKPTSC--SKFSKLP 414
+SL R+Q+ISQ + DRP L PT+ +KFS P
Sbjct: 164 VSLSRDQLISQALQDRPALAPPTASQNNKFSSPP 197


>sp|Q9XZ08|EXT3_DROME Exostosin-3 OS=Drosophila melanogaster GN=botv
PE=1 SV=1
Length = 972

Score = 30.8 bits (68), Expect = 4.3
Identities = 17/45 (37%), Positives = 22/45 (48%)
Frame = -2

Query: 357 NLLRNYLLSSEADTLYRCATVRSIESACIIERHTWPKGHSLXXPP 223
NL R L S + LYR T+R+I ER + G+ L PP
Sbjct: 337 NLARRDLTSHRTNPLYRQNTMRAIVVQSAFEREQFRPGYDLIVPP 381


>sp|Q6CUC6|TAF4_KLULA Transcription initiation factor TFIID subunit
4 OS=Kluyveromyces lactis GN=TAF4 PE=3 SV=1
Length = 366

Score = 30.4 bits (67), Expect = 5.6
Identities = 22/59 (37%), Positives = 29/59 (49%)
Frame = +3

Query: 66 TSVSASHRKLPKATASRTNLLSPARLSIIATSLPVTSETSKKFEVPWASAKRGGGXKGN 242
T V+ LPKA++ TNL SP S +L TS TSK+ + K GG G+
Sbjct: 50 TMVTEQPLALPKASSPTTNLASPRNSS--TPNLKTTSTTSKQSQKA-EQKKNAGGSTGS 105


>sp|Q2EEW9|RPOC1_HELSJ DNA-directed RNA polymerase subunit gamma
OS=Helicosporidium sp. subsp. Simulium jonesii GN=rpoC1
PE=3 SV=1
Length = 834

Score = 29.6 bits (65), Expect = 9.7
Identities = 13/38 (34%), Positives = 22/38 (57%)
Frame = +2

Query: 359 LIDRCLKSLHPVPNFPNYQTPKLLKEWLTFLSQRYHVY 472
L+ + KSLH + N ++ K W+ FLS++ H+Y
Sbjct: 142 LLMKSKKSLHLLLNMDSFFYFPSYKNWVNFLSEKNHIY 179


>sp|Q9UV10|HET6_NEUCR Heterokaryon incompatibility protein 6, OR
allele OS=Neurospora crassa GN=het-6 PE=4 SV=1
Length = 680

Score = 29.6 bits (65), Expect = 9.7
Identities = 25/94 (26%), Positives = 39/94 (41%), Gaps = 4/94 (4%)
Frame = +2

Query: 242 WPFGQVCLSMMQALSIDRTVAQRYNVSASEESK*FRSKFLIDRCLKSLHPVPNFPNYQT- 418
W + CL + V + VSA + F ++D+CL+ L P+ P Y T
Sbjct: 237 WTIQEFCLCADTIFACGYKVVSQKMVSALTD---FMRCIIMDKCLRGLLETPDTPTYSTL 293

Query: 419 -PKLLKEWLTFLSQRY--HVYRPGTSRRLLDAFF 511
L++ + F + Y + YR T LL F
Sbjct: 294 FSGLMRLFPLFQHRGYCQYPYRKETLEHLLVELF 327


tr_hit_id B6TEU7
Definition tr|B6TEU7|B6TEU7_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 42
Score (bit) 53.5
E-value 1.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912384|Adiantum capillus-veneris mRNA, clone:
YMU001_000018_D11.
(535 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6TEU7|B6TEU7_MAIZE Putative uncharacterized protein OS=Zea m... 54 1e-12
tr|B4G0A9|B4G0A9_MAIZE Putative uncharacterized protein OS=Zea m... 54 1e-12
tr|A9PIE4|A9PIE4_POPTR Putative uncharacterized protein OS=Popul... 53 2e-12
tr|A7QTZ7|A7QTZ7_VITVI Chromosome undetermined scaffold_174, who... 52 6e-12
tr|A9PF86|A9PF86_POPTR Putative uncharacterized protein OS=Popul... 51 5e-11
tr|B7FJF5|B7FJF5_MEDTR Putative uncharacterized protein OS=Medic... 48 1e-10
tr|Q10DW0|Q10DW0_ORYSJ Os03g0717900 protein OS=Oryza sativa subs... 54 2e-10
tr|A3AM41|A3AM41_ORYSJ Putative uncharacterized protein OS=Oryza... 54 2e-10
tr|A2XLF0|A2XLF0_ORYSI Putative uncharacterized protein OS=Oryza... 54 2e-10
tr|Q10DV9|Q10DV9_ORYSJ cDNA clone:001-023-C09, full insert seque... 54 2e-10
tr|Q9LVJ0|Q9LVJ0_ARATH Gb|AAF02142.1 (Putative uncharacterized p... 49 3e-10
tr|Q8W4L9|Q8W4L9_ARATH Putative uncharacterized protein At3g1780... 49 3e-10
tr|Q0WNF6|Q0WNF6_ARATH Putative uncharacterized protein At3g1780... 49 3e-10
tr|Q9LP80|Q9LP80_ARATH T1N15.6 (Putative uncharacterized protein... 50 7e-10
tr|Q9AT51|Q9AT51_BRANA Putative uncharacterized protein (Fragmen... 49 9e-10
tr|A5BZG6|A5BZG6_VITVI Putative uncharacterized protein OS=Vitis... 52 4e-09
tr|Q14K79|Q14K79_PLAAC Putative uncharacterized protein (Fragmen... 48 4e-09
tr|B8LKC1|B8LKC1_PICSI Putative uncharacterized protein OS=Picea... 46 1e-08
tr|Q9FVR1|Q9FVR1_ARATH Putative uncharacterized protein F3C3.6 (... 50 1e-08
tr|A7PC12|A7PC12_VITVI Chromosome chr2 scaffold_11, whole genome... 49 1e-08
tr|A5AE17|A5AE17_VITVI Putative uncharacterized protein OS=Vitis... 49 1e-08
tr|B6UFZ7|B6UFZ7_MAIZE Putative uncharacterized protein OS=Zea m... 44 3e-08
tr|Q56ZA5|Q56ZA5_ARATH Putative uncharacterized protein At3g1780... 49 5e-08
tr|B6TD75|B6TD75_MAIZE Putative uncharacterized protein OS=Zea m... 44 6e-08
tr|B4FPS1|B4FPS1_MAIZE Putative uncharacterized protein OS=Zea m... 44 6e-08
tr|Q2R4Y3|Q2R4Y3_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 45 7e-08
tr|A2ZDY7|A2ZDY7_ORYSI Putative uncharacterized protein OS=Oryza... 45 7e-08
tr|Q2R4Y4|Q2R4Y4_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 45 7e-08
tr|Q0ISV4|Q0ISV4_ORYSJ Os11g0456100 protein OS=Oryza sativa subs... 45 7e-08
tr|A5BNG8|A5BNG8_VITVI Putative uncharacterized protein OS=Vitis... 47 2e-07

>tr|B6TEU7|B6TEU7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 424

Score = 53.5 bits (127), Expect(2) = 1e-12
Identities = 24/42 (57%), Positives = 31/42 (73%)
Frame = -1

Query: 169 TGREVAMMLSLAGLRRLVLEAVAFGSFLWDAETLVDSHYTIV 44
+ ++ + +S AGLRRL+LEAV FGSFLWD E+ VDS Y V
Sbjct: 381 SSKDEHIRISFAGLRRLILEAVTFGSFLWDVESFVDSRYHFV 422



Score = 42.7 bits (99), Expect(2) = 1e-12
Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
Frame = -2

Query: 441 SHSFSNFGVW*FGKFGTGCRLFKQRSIKNL-LRNYLLSSEADTLYRCATVRSIESACIIE 265
S S G W F TG +SIK LR+Y++S ++DTL R ATVRS E+ IIE
Sbjct: 303 SSSHPEMGSWTAPAFSTGG---PSQSIKPCRLRSYVMSFDSDTLQRYATVRSKEAFGIIE 359

Query: 264 RHT 256
+HT
Sbjct: 360 KHT 362


>tr|B4G0A9|B4G0A9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 423

Score = 53.5 bits (127), Expect(2) = 1e-12
Identities = 24/42 (57%), Positives = 31/42 (73%)
Frame = -1

Query: 169 TGREVAMMLSLAGLRRLVLEAVAFGSFLWDAETLVDSHYTIV 44
+ ++ + +S AGLRRL+LEAV FGSFLWD E+ VDS Y V
Sbjct: 380 SSKDEHIRISFAGLRRLILEAVTFGSFLWDVESFVDSRYHFV 421



Score = 42.7 bits (99), Expect(2) = 1e-12
Identities = 29/63 (46%), Positives = 37/63 (58%), Gaps = 1/63 (1%)
Frame = -2

Query: 441 SHSFSNFGVW*FGKFGTGCRLFKQRSIKNL-LRNYLLSSEADTLYRCATVRSIESACIIE 265
S S G W F TG +SIK LR+Y++S ++DTL R ATVRS E+ IIE
Sbjct: 302 SSSHPEMGSWTAPAFSTGG---PSQSIKPCRLRSYVMSFDSDTLQRYATVRSKEAFGIIE 358

Query: 264 RHT 256
+HT
Sbjct: 359 KHT 361


>tr|A9PIE4|A9PIE4_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 417

Score = 53.1 bits (126), Expect(2) = 2e-12
Identities = 24/42 (57%), Positives = 30/42 (71%)
Frame = -1

Query: 169 TGREVAMMLSLAGLRRLVLEAVAFGSFLWDAETLVDSHYTIV 44
T ++ + +SL GL+RL LEAV FGSFLWD E+ VDS Y V
Sbjct: 374 TSKDEVVTISLGGLKRLALEAVTFGSFLWDVESYVDSRYHFV 415



Score = 42.7 bits (99), Expect(2) = 2e-12
Identities = 23/50 (46%), Positives = 32/50 (64%)
Frame = -2

Query: 405 GKFGTGCRLFKQRSIKNLLRNYLLSSEADTLYRCATVRSIESACIIERHT 256
G FG G + + LRNY++S +A+TL R AT+RS E+ IIE+HT
Sbjct: 313 GGFGHGLKASR-------LRNYVMSFDAETLQRYATIRSKEAVSIIEKHT 355


>tr|A7QTZ7|A7QTZ7_VITVI Chromosome undetermined scaffold_174, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00006608001 PE=4 SV=1
Length = 362

Score = 51.6 bits (122), Expect(2) = 6e-12
Identities = 23/42 (54%), Positives = 30/42 (71%)
Frame = -1

Query: 169 TGREVAMMLSLAGLRRLVLEAVAFGSFLWDAETLVDSHYTIV 44
+ ++ + +S GL+RLVLEAV FGSFLWD E+ VDS Y V
Sbjct: 319 SSKDELIKISFGGLKRLVLEAVTFGSFLWDVESFVDSRYHFV 360



Score = 42.4 bits (98), Expect(2) = 6e-12
Identities = 23/50 (46%), Positives = 32/50 (64%)
Frame = -2

Query: 405 GKFGTGCRLFKQRSIKNLLRNYLLSSEADTLYRCATVRSIESACIIERHT 256
G FG G + + LRNY++S +A+TL R AT+RS E+ IIE+HT
Sbjct: 258 GGFGHGIK-------PSRLRNYVMSFDAETLQRYATIRSKEAVSIIEKHT 300


>tr|A9PF86|A9PF86_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 401

Score = 51.2 bits (121), Expect(2) = 5e-11
Identities = 23/42 (54%), Positives = 30/42 (71%)
Frame = -1

Query: 169 TGREVAMMLSLAGLRRLVLEAVAFGSFLWDAETLVDSHYTIV 44
+ ++ + +S GL+RLVLEAV FGSFLWD E+ VDS Y V
Sbjct: 358 SSKDELVKISFGGLKRLVLEAVTFGSFLWDVESYVDSRYHFV 399



Score = 39.7 bits (91), Expect(2) = 5e-11
Identities = 17/32 (53%), Positives = 25/32 (78%)
Frame = -2

Query: 351 LRNYLLSSEADTLYRCATVRSIESACIIERHT 256
LRNY++S + +TL R AT+RS E+ +IE+HT
Sbjct: 308 LRNYVMSFDGETLQRYATIRSKEAVSLIEKHT 339


>tr|B7FJF5|B7FJF5_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 421

Score = 47.8 bits (112), Expect(2) = 1e-10
Identities = 22/34 (64%), Positives = 24/34 (70%)
Frame = -1

Query: 145 LSLAGLRRLVLEAVAFGSFLWDAETLVDSHYTIV 44
+S GL RLVLEAV FG FLWD E+ VDS Y V
Sbjct: 386 ISFGGLMRLVLEAVTFGCFLWDVESYVDSRYRFV 419



Score = 42.0 bits (97), Expect(2) = 1e-10
Identities = 19/32 (59%), Positives = 25/32 (78%)
Frame = -2

Query: 351 LRNYLLSSEADTLYRCATVRSIESACIIERHT 256
LRNY++S + DTL R AT+RS E+ IIE+HT
Sbjct: 328 LRNYVMSFDGDTLQRYATIRSKEAVSIIEKHT 359


>tr|Q10DW0|Q10DW0_ORYSJ Os03g0717900 protein OS=Oryza sativa subsp.
japonica GN=Os03g0717900 PE=2 SV=1
Length = 455

Score = 53.9 bits (128), Expect(2) = 2e-10
Identities = 24/43 (55%), Positives = 32/43 (74%)
Frame = -1

Query: 169 TGREVAMMLSLAGLRRLVLEAVAFGSFLWDAETLVDSHYTIVA 41
+ ++ + +S AGLRRL+LEAV FGSFLWD E+ VD+ Y VA
Sbjct: 412 SSKDEHVRISFAGLRRLILEAVTFGSFLWDVESFVDTRYHFVA 454



Score = 35.0 bits (79), Expect(2) = 2e-10
Identities = 16/32 (50%), Positives = 25/32 (78%)
Frame = -2

Query: 351 LRNYLLSSEADTLYRCATVRSIESACIIERHT 256
LR+Y++S +++TL AT+RS E+ IIE+HT
Sbjct: 362 LRSYVMSFDSETLQSYATIRSKEAFGIIEKHT 393


>tr|A3AM41|A3AM41_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_011863 PE=4 SV=1
Length = 413

Score = 53.9 bits (128), Expect(2) = 2e-10
Identities = 24/43 (55%), Positives = 32/43 (74%)
Frame = -1

Query: 169 TGREVAMMLSLAGLRRLVLEAVAFGSFLWDAETLVDSHYTIVA 41
+ ++ + +S AGLRRL+LEAV FGSFLWD E+ VD+ Y VA
Sbjct: 370 SSKDEHVRISFAGLRRLILEAVTFGSFLWDVESFVDTRYHFVA 412



Score = 35.0 bits (79), Expect(2) = 2e-10
Identities = 16/32 (50%), Positives = 25/32 (78%)
Frame = -2

Query: 351 LRNYLLSSEADTLYRCATVRSIESACIIERHT 256
LR+Y++S +++TL AT+RS E+ IIE+HT
Sbjct: 320 LRSYVMSFDSETLQSYATIRSKEAFGIIEKHT 351


>tr|A2XLF0|A2XLF0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_13299 PE=4 SV=1
Length = 413

Score = 53.9 bits (128), Expect(2) = 2e-10
Identities = 24/43 (55%), Positives = 32/43 (74%)
Frame = -1

Query: 169 TGREVAMMLSLAGLRRLVLEAVAFGSFLWDAETLVDSHYTIVA 41
+ ++ + +S AGLRRL+LEAV FGSFLWD E+ VD+ Y VA
Sbjct: 370 SSKDEHVRISFAGLRRLILEAVTFGSFLWDVESFVDTRYHFVA 412



Score = 35.0 bits (79), Expect(2) = 2e-10
Identities = 16/32 (50%), Positives = 25/32 (78%)
Frame = -2

Query: 351 LRNYLLSSEADTLYRCATVRSIESACIIERHT 256
LR+Y++S +++TL AT+RS E+ IIE+HT
Sbjct: 320 LRSYVMSFDSETLQSYATIRSKEAFGIIEKHT 351


>tr|Q10DV9|Q10DV9_ORYSJ cDNA clone:001-023-C09, full insert sequence
OS=Oryza sativa subsp. japonica GN=LOC_Os03g50870 PE=2
SV=1
Length = 328

Score = 53.9 bits (128), Expect(2) = 2e-10
Identities = 24/43 (55%), Positives = 32/43 (74%)
Frame = -1

Query: 169 TGREVAMMLSLAGLRRLVLEAVAFGSFLWDAETLVDSHYTIVA 41
+ ++ + +S AGLRRL+LEAV FGSFLWD E+ VD+ Y VA
Sbjct: 285 SSKDEHVRISFAGLRRLILEAVTFGSFLWDVESFVDTRYHFVA 327



Score = 35.0 bits (79), Expect(2) = 2e-10
Identities = 16/32 (50%), Positives = 25/32 (78%)
Frame = -2

Query: 351 LRNYLLSSEADTLYRCATVRSIESACIIERHT 256
LR+Y++S +++TL AT+RS E+ IIE+HT
Sbjct: 235 LRSYVMSFDSETLQSYATIRSKEAFGIIEKHT 266