BP912396
Clone id YMU001_000018_E11
Library
Length 619
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000018_E11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAGATATTACCTGCAGGTACTCGCTTCTTCCAGGTCATCAATAGAGCTTGCTGAGATCGT
CCATTGATCGAGGTCGCCATGGCTGTTGCAACCGTTGCAACCTCCTCTCTCCACCTCGCT
TGCTCCTCAAGCGCCGCGGGAGAGTCCAAGGTTCTATCCCGCCGTGGTCCCTGCTTGCTA
GCTCCCGCTCCTGGCCGGGCTTCTCCTCTCAAGCTCGTCTCCAATGGCAGCCGCGTCTCT
ATGAGTGCGGATGGAAAGAAAGAGATCAGCCTTGCGGCACCGGCGGCCCTCGCTGTACTT
GCTGCAGCAGTTATTCCAGATATGGCTGAGGCTGTTGCTCCTGGAGTATCACCCTCGCTG
AAGAACCTTCTGCTTAGTGTTGTAGCAGGAGGTGTTGTCCTTGTTGCCATTGGAGGTGCC
GTTGCTGCTGTCTCGACCTTTGACCCTGTCAAGCGGAAGTGATTCTGCTAGTTGCTCGTT
TGCTTCTCTTGGACTGAAATTTTTGCAGTTTAAAGCTTACAGCTCATAGAAGCTTGCATA
TATGATCAGTAATGGCTTGAAGGCCTTGACCCTTGAATTTGTAGTGAGAGTAATTGACTG
GCTTGAGCAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912396|Adiantum capillus-veneris mRNA, clone:
YMU001_000018_E11.
(608 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id A9STC1
Definition tr|A9STC1|A9STC1_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 106
Score (bit) 54.3
E-value 5.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912396|Adiantum capillus-veneris mRNA, clone:
YMU001_000018_E11.
(608 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9STC1|A9STC1_PHYPA Predicted protein OS=Physcomitrella paten... 54 5e-06
tr|A9TK82|A9TK82_PHYPA Predicted protein OS=Physcomitrella paten... 53 1e-05
tr|A9TSL8|A9TSL8_PHYPA Predicted protein OS=Physcomitrella paten... 52 2e-05
tr|A9RVW4|A9RVW4_PHYPA Predicted protein OS=Physcomitrella paten... 50 1e-04
tr|A9NTS2|A9NTS2_PICSI Putative uncharacterized protein OS=Picea... 49 2e-04
tr|A9NK10|A9NK10_PICSI Putative uncharacterized protein OS=Picea... 42 0.021
tr|A8XM20|A8XM20_CAEBR Putative uncharacterized protein OS=Caeno... 39 0.31
tr|A9PJ43|A9PJ43_POPJC Putative uncharacterized protein OS=Popul... 36 2.0
tr|A9PIY2|A9PIY2_POPJC Putative uncharacterized protein OS=Popul... 36 2.0
tr|A5BCY2|A5BCY2_VITVI Putative uncharacterized protein OS=Vitis... 36 2.0
tr|Q9SKI3|Q9SKI3_ARATH Expressed protein (Putative PSII-X protei... 35 2.6
tr|B6SXA1|B6SXA1_MAIZE Ultraviolet-B-repressible protein OS=Zea ... 35 2.6
tr|B6SX50|B6SX50_MAIZE Ultraviolet-B-repressible protein OS=Zea ... 35 2.6
tr|A3MVN7|A3MVN7_PYRCJ Putative uncharacterized protein OS=Pyrob... 35 3.4
tr|A9PJ86|A9PJ86_POPJC Putative uncharacterized protein OS=Popul... 35 4.4
tr|A9PE66|A9PE66_POPTR Putative uncharacterized protein OS=Popul... 35 4.4
tr|Q86K33|Q86K33_DICDI Putative uncharacterized protein OS=Dicty... 34 5.8
tr|Q54ZU4|Q54ZU4_DICDI RmlC-like cupin family protein OS=Dictyos... 34 5.8
tr|B6TNV5|B6TNV5_MAIZE Ultraviolet-B-repressible protein OS=Zea ... 33 9.8
tr|B6T4G5|B6T4G5_MAIZE Ultraviolet-B-repressible protein OS=Zea ... 33 9.8
tr|A7P4S0|A7P4S0_VITVI Chromosome chr4 scaffold_6, whole genome ... 33 9.8

>tr|A9STC1|A9STC1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_166457 PE=4 SV=1
Length = 238

Score = 54.3 bits (129), Expect = 5e-06
Identities = 42/106 (39%), Positives = 49/106 (46%)
Frame = +1

Query: 142 ESKVLSRRGPCLLAPAPGRASPLKLVSNGSRVSMSADGKKEISXXXXXXXXXXXXXXIPD 321
E K LSR+G L AP RAS ++V N SRV MSA + +P+
Sbjct: 138 EGKTLSRQGLALAAPP--RAS--RMVVNRSRVVMSAT-PSDNKVVSLTSLALLAAAVVPE 192

Query: 322 MAEAVAPGVSPSLKNXXXXXXXXXXXXXXXXXXXXXXSTFDPVKRK 459
+AEA PGVSPSLKN STFDPVKRK
Sbjct: 193 IAEAAQPGVSPSLKNLLLSVVAGGTVLTVIGVAVAGVSTFDPVKRK 238


>tr|A9TK82|A9TK82_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_170551 PE=4 SV=1
Length = 126

Score = 53.1 bits (126), Expect = 1e-05
Identities = 38/106 (35%), Positives = 50/106 (47%)
Frame = +1

Query: 142 ESKVLSRRGPCLLAPAPGRASPLKLVSNGSRVSMSADGKKEISXXXXXXXXXXXXXXIPD 321
E K LSR+G L A +P R + ++ N SRV MSA ++ + +P+
Sbjct: 23 EGKTLSRQGLSLAAASPLRMAG-QVAMNRSRVVMSA-APQDKNVAGLTSLALLAAAVVPE 80

Query: 322 MAEAVAPGVSPSLKNXXXXXXXXXXXXXXXXXXXXXXSTFDPVKRK 459
+AEA PG+SPSLKN STFDPVKRK
Sbjct: 81 IAEAAQPGISPSLKNLLLSVVAGGTVLTVIGVAVAGVSTFDPVKRK 126


>tr|A9TSL8|A9TSL8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_171698 PE=4 SV=1
Length = 140

Score = 52.4 bits (124), Expect = 2e-05
Identities = 42/122 (34%), Positives = 54/122 (44%), Gaps = 16/122 (13%)
Frame = +1

Query: 142 ESKVLSRRGPCLLAPAPGRASPLKLVSNGSRVSMS----------------ADGKKEISX 273
E+K+LSR+G L AP+ R+S KL++N SRV MS A + +
Sbjct: 22 EAKILSRQGLALAAPSV-RSS--KLIANRSRVVMSNSLSSAAAEIVVSLGCASPQSDNKL 78

Query: 274 XXXXXXXXXXXXXIPDMAEAVAPGVSPSLKNXXXXXXXXXXXXXXXXXXXXXXSTFDPVK 453
+P++AEA PGVSPSLKN STFDPVK
Sbjct: 79 AALTSLAFLAAAVVPEIAEAAQPGVSPSLKNLLLSVVAGGVVVTVIGVAVAGVSTFDPVK 138

Query: 454 RK 459
RK
Sbjct: 139 RK 140


>tr|A9RVW4|A9RVW4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_161232 PE=4 SV=1
Length = 125

Score = 50.1 bits (118), Expect = 1e-04
Identities = 33/105 (31%), Positives = 46/105 (43%)
Frame = +1

Query: 145 SKVLSRRGPCLLAPAPGRASPLKLVSNGSRVSMSADGKKEISXXXXXXXXXXXXXXIPDM 324
+K+ S +G L P G+ +SNG+RVSMS K+ + +P++
Sbjct: 22 AKLPSHKGLALATPL-GKKQVSVAISNGNRVSMSLPAKENHNVMSLTGLALVAAAVVPEI 80

Query: 325 AEAVAPGVSPSLKNXXXXXXXXXXXXXXXXXXXXXXSTFDPVKRK 459
AEA PGVS SL+N STFDPV R+
Sbjct: 81 AEAAQPGVSDSLRNLLLSVLAGGVVISVIGVAVAGVSTFDPVSRR 125


>tr|A9NTS2|A9NTS2_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 129

Score = 49.3 bits (116), Expect = 2e-04
Identities = 36/94 (38%), Positives = 39/94 (41%), Gaps = 1/94 (1%)
Frame = +1

Query: 178 LAPAPGRASPLKLVSNGSRVSMSAD-GKKEISXXXXXXXXXXXXXXIPDMAEAVAPGVSP 354
L P + KL SN SRV M A GKKE S IP++AEA GVSP
Sbjct: 35 LFTTPNKLYSPKLASNRSRVVMHASQGKKEQSLAGLTSLALAAAMVIPEIAEAAGSGVSP 94

Query: 355 SLKNXXXXXXXXXXXXXXXXXXXXXXSTFDPVKR 456
SLKN S FDPVKR
Sbjct: 95 SLKNFLLSIAAGGVVATAIAGAVIGVSNFDPVKR 128


>tr|A9NK10|A9NK10_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 135

Score = 42.4 bits (98), Expect = 0.021
Identities = 32/94 (34%), Positives = 40/94 (42%), Gaps = 4/94 (4%)
Frame = +1

Query: 187 APGRASPLKLVSNG-SRVSMSADG---KKEISXXXXXXXXXXXXXXIPDMAEAVAPGVSP 354
+P + S KLV NG SRV M +++ + IP+MAEA PGVS
Sbjct: 41 SPNKPSSSKLVGNGKSRVVMMGKDISEREQSNYAGLTAVALAAAMVIPEMAEAAVPGVSA 100

Query: 355 SLKNXXXXXXXXXXXXXXXXXXXXXXSTFDPVKR 456
SLKN S+FDPVKR
Sbjct: 101 SLKNFLLSIASGSVVLGAIGVAVVGVSSFDPVKR 134


>tr|A8XM20|A8XM20_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG15371 PE=4 SV=2
Length = 1276

Score = 38.5 bits (88), Expect = 0.31
Identities = 28/94 (29%), Positives = 47/94 (50%), Gaps = 4/94 (4%)
Frame = -3

Query: 477 EQLAESLPLDRVKGRDSSNGTSNGNKDNTSCYNTK-QKVLQRG*YSRSNSLSHI---WNN 310
E+LAE + D +K + G N KD NT+ K++ +++LSH+ N
Sbjct: 206 EELAEDVVRDELKILEKIVGQLNERKDKMEAINTQAHKIVDTYTKDEAHNLSHLLSRMNM 265

Query: 309 CCSKYSEGRRCRKADLFLSIRTHRDAAAIGDELE 208
+K+++ R R+A L S+R+ RD + E E
Sbjct: 266 SWTKFNDNIRIRRAVLEASLRSRRDFHSALSEFE 299


>tr|A9PJ43|A9PJ43_POPJC Putative uncharacterized protein OS=Populus
jackii PE=2 SV=1
Length = 122

Score = 35.8 bits (81), Expect = 2.0
Identities = 19/48 (39%), Positives = 22/48 (45%)
Frame = +1

Query: 313 IPDMAEAVAPGVSPSLKNXXXXXXXXXXXXXXXXXXXXXXSTFDPVKR 456
IP++AEA PGVSPSL N S FDPV+R
Sbjct: 74 IPEVAEAAGPGVSPSLNNFLLSIVAGGVVLVAIAGAVVGVSNFDPVRR 121


>tr|A9PIY2|A9PIY2_POPJC Putative uncharacterized protein OS=Populus
jackii PE=2 SV=1
Length = 122

Score = 35.8 bits (81), Expect = 2.0
Identities = 19/48 (39%), Positives = 22/48 (45%)
Frame = +1

Query: 313 IPDMAEAVAPGVSPSLKNXXXXXXXXXXXXXXXXXXXXXXSTFDPVKR 456
IP++AEA PGVSPSL N S FDPV+R
Sbjct: 74 IPEVAEAAGPGVSPSLNNFLLSIVAGGVVLAAIAGAVVGVSNFDPVRR 121


>tr|A5BCY2|A5BCY2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_016134 PE=4 SV=1
Length = 254

Score = 35.8 bits (81), Expect = 2.0
Identities = 23/85 (27%), Positives = 39/85 (45%)
Frame = -3

Query: 450 DRVKGRDSSNGTSNGNKDNTSCYNTKQKVLQRG*YSRSNSLSHIWNNCCSKYSEGRRCRK 271
DR+KGR G+S ++D ++ + K S S + + + CSK E R +
Sbjct: 78 DRLKGRLRDEGSSRSHRDYSNSSTSANKRHASDLCSSSKRV--LEDGSCSKEEESLRDDE 135

Query: 270 ADLFLSIRTHRDAAAIGDELERRSP 196
+ FL+ R R A+G ++ P
Sbjct: 136 VEEFLNSRVKRGRGAVGSRMDEAGP 160