BP912404
Clone id YMU001_000018_F07
Library
Length 479
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000018_F07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTGTAAAAACACAAACCAACTATGTATCACATAAACACAAGTCAAATACAATGATGGCGA
ATTTGATATTTGCCGCGCTTCATAGCATGATGCTTCGTGTACCTTGATCCTCTTCGCACA
GGAGATCTCCTTCAAAGCTTTCTCAAAGCAGCTCTACTGGCGGCTCTTCTCGCACACGAA
CACCCTTCTAATAATGTCTTTTTTCCCCCTGCACTTTTGGAACTTCAACTTCCGGCCTGT
AACGTGTTGCCTTGCTTCCTCATGCTCAGGATCGGACCCTTGCCATATGCAGCCCCTCCA
ATCTACCGCACCTCAACCCTCTACTGTAGTCCCTCCATCTGCTTGCTCATGGCCCCAAAA
CTCCCGGCAATGGCCATTCCTAGAGCGCTGGCTGCTCTCAGCCTCTACCGTCCTTCTGCA
GTCACCCGCCGCCTTTTCACTTCCAGGCAAACCTCCTTTTACTGCTCTCGGACATGCTC
■■Homology search results ■■ -
sp_hit_id Q9Y2F5
Definition sp|Q9Y2F5|K0947_HUMAN Uncharacterized protein KIAA0947 OS=Homo sapiens
Align length 89
Score (bit) 35.0
E-value 0.18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912404|Adiantum capillus-veneris mRNA, clone:
YMU001_000018_F07.
(479 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9Y2F5|K0947_HUMAN Uncharacterized protein KIAA0947 OS=Homo s... 35 0.18
sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1 OS=Kluyvero... 33 0.67
sp|Q02096|PGLR_PERAE Polygalacturonase OS=Persea americana PE=2 ... 31 2.5
sp|Q9YTR7|L100_ADEP3 Late 100 kDa protein OS=Porcine adenovirus ... 31 3.3
sp|P01876|IGHA1_HUMAN Ig alpha-1 chain C region OS=Homo sapiens ... 31 3.3
sp|Q476U6|THIC_RALEJ Thiamine biosynthesis protein thiC OS=Ralst... 30 4.3
sp|P41246|MMP9_RABIT Matrix metalloproteinase-9 OS=Oryctolagus c... 30 5.6
sp|A2A5X5|KR10D_MOUSE Putative keratin-associated protein 10-lik... 30 7.4
sp|Q29RJ9|PSRC1_BOVIN Proline/serine-rich coiled-coil protein 1 ... 26 7.4
sp|A2VEC9|SSPO_HUMAN SCO-spondin OS=Homo sapiens GN=SSPO PE=2 SV=1 29 9.6
sp|Q7S4I9|RT106_NEUCR Histone chaperone rtt-106 OS=Neurospora cr... 29 9.6
sp|Q9H195|MUC3B_HUMAN Mucin-3B (Fragment) OS=Homo sapiens GN=MUC... 29 9.6
sp|A8MTN3|KRA2X_HUMAN Putative keratin-associated protein ENSP00... 29 9.6
sp|P23385|GRM1_RAT Metabotropic glutamate receptor 1 OS=Rattus n... 29 9.6
sp|P97772|GRM1_MOUSE Metabotropic glutamate receptor 1 OS=Mus mu... 29 9.6
sp|Q13255|GRM1_HUMAN Metabotropic glutamate receptor 1 OS=Homo s... 29 9.6

>sp|Q9Y2F5|K0947_HUMAN Uncharacterized protein KIAA0947 OS=Homo
sapiens GN=KIAA0947 PE=1 SV=4
Length = 2266

Score = 35.0 bits (79), Expect = 0.18
Identities = 29/89 (32%), Positives = 39/89 (43%), Gaps = 13/89 (14%)
Frame = +2

Query: 251 LASSCSGSDPCHMQPLQSTAPQPSTVVPPSACSWPQNSRQW----PFLERWLLSASTVLL 418
L SS S S P P+ +P T VPP+ WP++ R+ P SAS ++
Sbjct: 1653 LISSSSPSSPA--SPVGQVSPFRETPVPPAMSPWPEDPRRASPPDPSPSPSAASASERVV 1710

Query: 419 QSPAAF---------SLPGKPPFTALGHA 478
SP F +PG+ P A GHA
Sbjct: 1711 PSPLQFCAATPKHALPVPGRLPPCASGHA 1739


>sp|Q6CLR3|DED1_KLULA ATP-dependent RNA helicase DED1
OS=Kluyveromyces lactis GN=DED1 PE=3 SV=1
Length = 627

Score = 33.1 bits (74), Expect = 0.67
Identities = 22/69 (31%), Positives = 32/69 (46%), Gaps = 14/69 (20%)
Frame = -3

Query: 441 SEKAAGDCRRTV---EAESSQRSRNGHCR-----------EFWGHEQADGGTTVEG*GAV 304
S +GD RR+ QRS +G+ R F+G+E+ GG + G G+V
Sbjct: 18 SGATSGDSRRSYVPPHVRGQQRSGSGNYRGRSDNFGGNERSFFGNERRGGGYSRGGRGSV 77

Query: 303 DWRGCIWQG 277
+W G W G
Sbjct: 78 NWGGSNWGG 86


>sp|Q02096|PGLR_PERAE Polygalacturonase OS=Persea americana PE=2
SV=1
Length = 462

Score = 31.2 bits (69), Expect = 2.5
Identities = 31/133 (23%), Positives = 54/133 (40%), Gaps = 1/133 (0%)
Frame = -3

Query: 417 RRTVEAESSQRSRNGHCREFWGHEQADGGTTVEG*GAVDWRGCIWQGSDPEHEEARQHVT 238
R T+EA S Q GH R+ W + T+EG G + G W S + +++ +
Sbjct: 145 RGTIEASSDQSDWVGHNRKRWIEFEDISNLTLEGGGTSNGNGETWWDSSCKRKKSLPCKS 204

Query: 237 G-RKLKFQKCRGKKDIIRRVFVCEKSRQ*SCFEKALKEISCAKRIKVHEASCYEARQISN 61
L F+ C K I+ + + + + F+K I+ + E S N
Sbjct: 205 APTALTFRSC--KNLIVSDLSIKDSQKMHLSFDKCQDVIASNLMVTAPEHS-------PN 255

Query: 60 SPSLYLTCVYVIH 22
+ +++T IH
Sbjct: 256 TDGIHITGTQRIH 268


>sp|Q9YTR7|L100_ADEP3 Late 100 kDa protein OS=Porcine adenovirus A
serotype 3 PE=3 SV=1
Length = 838

Score = 30.8 bits (68), Expect = 3.3
Identities = 23/70 (32%), Positives = 31/70 (44%), Gaps = 10/70 (14%)
Frame = +2

Query: 242 TCCLASSCSGSDPCHMQPLQSTAPQPS--TVVPPSAC--------SWPQNSRQWPFLERW 391
TC +SS S S C + PL+ T+ + S TV+P P L+R
Sbjct: 52 TCSSSSSSSASSECFVSPLEDTSSEDSADTVLPSEPRRDEEEQEEDSPDRYMDADVLQRH 111

Query: 392 LLSASTVLLQ 421
LL ST+L Q
Sbjct: 112 LLRQSTILRQ 121


>sp|P01876|IGHA1_HUMAN Ig alpha-1 chain C region OS=Homo sapiens
GN=IGHA1 PE=1 SV=2
Length = 353

Score = 30.8 bits (68), Expect = 3.3
Identities = 25/76 (32%), Positives = 32/76 (42%), Gaps = 16/76 (21%)
Frame = +2

Query: 236 PVTCCLASSCSGSDPCHMQ-------------PLQSTAPQPSTVVPPS---ACSWPQNSR 367
P T CLA S CH++ P+ ST P PS PP+ +C P+ S
Sbjct: 73 PATQCLAGK---SVTCHVKHYTNPSQDVTVPCPVPSTPPTPSPSTPPTPSPSCCHPRLSL 129

Query: 368 QWPFLERWLLSASTVL 415
P LE LL + L
Sbjct: 130 HRPALEDLLLGSEANL 145


>sp|Q476U6|THIC_RALEJ Thiamine biosynthesis protein thiC
OS=Ralstonia eutropha (strain JMP134) GN=thiC PE=3 SV=1
Length = 626

Score = 30.4 bits (67), Expect = 4.3
Identities = 15/62 (24%), Positives = 29/62 (46%)
Frame = +1

Query: 187 SNNVFFPPALLELQLPACNVLPCFLMLRIGPLPYAAPPIYRTSTLYCSPSICLLMAPKLP 366
S+ + P + ++++P +L G +P P+Y TS Y P + + + LP
Sbjct: 26 SSKTYIPGSRPDIRVPMRTILQTSTRTEKGEMPNPPIPVYDTSGPYSDPDVHIDLKAGLP 85

Query: 367 AM 372
A+
Sbjct: 86 AL 87


>sp|P41246|MMP9_RABIT Matrix metalloproteinase-9 OS=Oryctolagus
cuniculus GN=MMP9 PE=2 SV=1
Length = 707

Score = 30.0 bits (66), Expect = 5.6
Identities = 12/27 (44%), Positives = 16/27 (59%), Gaps = 1/27 (3%)
Frame = +2

Query: 290 QPLQSTAPQPSTVVPPSAC-SWPQNSR 367
QP +T P+P PP+AC +WP R
Sbjct: 450 QPPATTTPEPQPTAPPTACPTWPATVR 476


>sp|A2A5X5|KR10D_MOUSE Putative keratin-associated protein 10-like
ENSP00000375147 homolog OS=Mus musculus PE=3 SV=1
Length = 502

Score = 29.6 bits (65), Expect = 7.4
Identities = 17/46 (36%), Positives = 21/46 (45%), Gaps = 8/46 (17%)
Frame = +2

Query: 233 RPVTC--------CLASSCSGSDPCHMQPLQSTAPQPSTVVPPSAC 346
RPV C C++SSC S C Q P+PS + PS C
Sbjct: 269 RPVCCVQGPCEPPCVSSSCQDSSCCVSSICQPVCPEPSPCL-PSVC 313


>sp|Q29RJ9|PSRC1_BOVIN Proline/serine-rich coiled-coil protein 1
OS=Bos taurus GN=PSRC1 PE=2 SV=1
Length = 326

Score = 25.8 bits (55), Expect(2) = 7.4
Identities = 10/32 (31%), Positives = 17/32 (53%)
Frame = +1

Query: 208 PALLELQLPACNVLPCFLMLRIGPLPYAAPPI 303
P+ ++ + P CN+ P PL +APP+
Sbjct: 168 PSSVKRESPTCNLFPASKSPASSPLARSAPPV 199



Score = 21.9 bits (45), Expect(2) = 7.4
Identities = 15/50 (30%), Positives = 22/50 (44%)
Frame = +2

Query: 299 QSTAPQPSTVVPPSACSWPQNSRQWPFLERWLLSASTVLLQSPAAFSLPG 448
++TA P+ V P A P S Q P + + + L P+A PG
Sbjct: 208 RATASPPTPVRPVLAPQPPAGSSQRPSRPQGAAAKPSSRLPVPSAVPRPG 257


>sp|A2VEC9|SSPO_HUMAN SCO-spondin OS=Homo sapiens GN=SSPO PE=2 SV=1
Length = 5147

Score = 29.3 bits (64), Expect = 9.6
Identities = 21/71 (29%), Positives = 29/71 (40%), Gaps = 22/71 (30%)
Frame = +2

Query: 227 NFRPVTCC----LASSCSGSDPC---HMQPLQSTAPQP---------------STVVPPS 340
N +P C + S+C+ S PC H+QP +P T VPP+
Sbjct: 4811 NLQPCPECPPGQVLSACATSCPCLCWHLQPGAICVQEPCQPGCGCPGGQLLHNGTCVPPT 4870

Query: 341 ACSWPQNSRQW 373
AC Q+S W
Sbjct: 4871 ACPCTQHSLPW 4881


tr_hit_id Q0CI67
Definition tr|Q0CI67|Q0CI67_ASPTN Putative uncharacterized protein OS=Aspergillus terreus (strain NIH 2624)
Align length 66
Score (bit) 39.3
E-value 0.098
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912404|Adiantum capillus-veneris mRNA, clone:
YMU001_000018_F07.
(479 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0CI67|Q0CI67_ASPTN Putative uncharacterized protein OS=Asper... 39 0.098
tr|B6TBA7|B6TBA7_MAIZE Putative uncharacterized protein OS=Zea m... 38 0.22
tr|O13391|O13391_COCHE Beta glucosidase homolog OS=Cochliobolus ... 37 0.37
tr|O13385|O13385_COCHE Beta glucosidase homolog OS=Cochliobolus ... 37 0.37
tr|Q8SCI0|Q8SCI0_9VIRU Orf6 OS=Propionibacterium phage B5 PE=4 SV=1 36 0.83
tr|A2QBQ6|A2QBQ6_ASPNC Remark: only the region of the MYND finge... 36 0.83
tr|Q4S078|Q4S078_TETNG Chromosome undetermined SCAF14784, whole ... 35 2.4
tr|B6SVR3|B6SVR3_MAIZE RKF3 OS=Zea mays PE=2 SV=1 35 2.4
tr|Q6JRV8|Q6JRV8_XENLA RTN4.2-A2 OS=Xenopus laevis GN=RTN4 PE=2 ... 34 3.2
tr|A1WRK9|A1WRK9_VEREI UDP-N-acetylmuramoylalanine--D-glutamate ... 33 5.4
tr|Q8LI16|Q8LI16_ORYSJ Putative uncharacterized protein OJ1199_H... 33 5.4
tr|Q0D563|Q0D563_ORYSJ Os07g0578800 protein OS=Oryza sativa subs... 33 5.4
tr|A3BLI2|A3BLI2_ORYSJ Putative uncharacterized protein OS=Oryza... 33 5.4
tr|Q2GMP5|Q2GMP5_CHAGB Predicted protein OS=Chaetomium globosum ... 33 5.4
tr|A1DMR8|A1DMR8_NEOFI Beta glucosidase, putative OS=Neosartorya... 33 5.4
tr|A2C7R9|A2C7R9_PROM3 Creatininase OS=Prochlorococcus marinus (... 33 7.0
tr|Q0UTZ6|Q0UTZ6_PHANO Putative uncharacterized protein OS=Phaeo... 33 7.0
tr|Q7V6D3|Q7V6D3_PROMM Creatininase OS=Prochlorococcus marinus (... 33 9.2
tr|Q4IYZ2|Q4IYZ2_AZOVI Sua5/YciO/YrdC/YwlC OS=Azotobacter vinela... 33 9.2
tr|Q93763|Q93763_CAEEL Protein F53C11.5b, partially confirmed by... 33 9.2
tr|Q1HAZ9|Q1HAZ9_CAEEL Protein F53C11.5a, partially confirmed by... 33 9.2
tr|Q1HAZ8|Q1HAZ8_CAEEL Protein F53C11.5c, partially confirmed by... 33 9.2
tr|Q753L6|Q753L6_ASHGO AFR296Cp OS=Ashbya gossypii GN=AFR296C PE... 33 9.2
tr|Q6BJT8|Q6BJT8_DEBHA DEHA2G00110p OS=Debaryomyces hansenii GN=... 33 9.2
tr|B5RSN5|B5RSN5_DEBHA DEHA2A00110p OS=Debaryomyces hansenii GN=... 33 9.2

>tr|Q0CI67|Q0CI67_ASPTN Putative uncharacterized protein
OS=Aspergillus terreus (strain NIH 2624) GN=ATEG_06617
PE=4 SV=1
Length = 867

Score = 39.3 bits (90), Expect = 0.098
Identities = 24/66 (36%), Positives = 36/66 (54%), Gaps = 2/66 (3%)
Frame = +2

Query: 203 FPLHFWNFNFRPVTCCLASSCSGSDPCHMQPLQSTAPQPSTVVPPSA-CSWPQN-SRQWP 376
+ L + NFNF + SS + P P ST P+ ST +PP+A +WP+N +R W
Sbjct: 652 YGLSYTNFNFSRASISAQSSLDTAYPAPRSPKGST-PEYSTAIPPAAEAAWPKNFNRIWR 710

Query: 377 FLERWL 394
+L +L
Sbjct: 711 YLYPYL 716


>tr|B6TBA7|B6TBA7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 537

Score = 38.1 bits (87), Expect = 0.22
Identities = 18/70 (25%), Positives = 38/70 (54%), Gaps = 5/70 (7%)
Frame = -3

Query: 303 DWRGCIWQGSDPEHEEA--RQHVTGRKLKFQKCRGKKDIIRRVFVCEKSRQ*SCFEKAL- 133
DWR + + S P H+E+ + + K+++Q+C G + I + F+ ++ + A+
Sbjct: 338 DWRKLVEKWSTPNHKESCVKNKLNREKVQYQQCTGSQSYIAKAFILKQEKYKDAEPSAID 397

Query: 132 --KEISCAKR 109
KE+ C+K+
Sbjct: 398 LFKEMHCSKK 407


>tr|O13391|O13391_COCHE Beta glucosidase homolog OS=Cochliobolus
heterostrophus GN=BGL1 PE=4 SV=1
Length = 870

Score = 37.4 bits (85), Expect = 0.37
Identities = 32/111 (28%), Positives = 50/111 (45%), Gaps = 9/111 (8%)
Frame = +2

Query: 140 FSKQLY--WRLFSHTNTLLIMSF-FPLHFWNFNFRPVTCCLASSCSGSDPCHMQPLQSTA 310
F++ LY +R F N +F L + F+F T + + + P +P + T
Sbjct: 622 FTEGLYIDYRHFHKANITPRYAFGHGLSYTTFSFSDATITPVTPLTRTPPA--RPAKGTT 679

Query: 311 PQPSTVVPP-SACSWPQN-SRQWPFLERWL----LSASTVLLQSPAAFSLP 445
P ST +PP S WP N +R W +L WL A+ + SP+ + P
Sbjct: 680 PSYSTAIPPASEAYWPANFNRIWRYLYSWLDKNDADAAAQVGTSPSTYPYP 730


>tr|O13385|O13385_COCHE Beta glucosidase homolog OS=Cochliobolus
heterostrophus GN=BGL1 PE=4 SV=1
Length = 870

Score = 37.4 bits (85), Expect = 0.37
Identities = 32/111 (28%), Positives = 50/111 (45%), Gaps = 9/111 (8%)
Frame = +2

Query: 140 FSKQLY--WRLFSHTNTLLIMSF-FPLHFWNFNFRPVTCCLASSCSGSDPCHMQPLQSTA 310
F++ LY +R F N +F L + F+F T + + + P +P + T
Sbjct: 622 FTEGLYIDYRHFHKANITPRYAFGHGLSYTTFSFSDATITPVTPLTRTPPA--RPAKGTT 679

Query: 311 PQPSTVVPP-SACSWPQN-SRQWPFLERWL----LSASTVLLQSPAAFSLP 445
P ST +PP S WP N +R W +L WL A+ + SP+ + P
Sbjct: 680 PSYSTAIPPASEAYWPANFNRIWRYLYSWLDKNDADAAAQVGTSPSTYPYP 730


>tr|Q8SCI0|Q8SCI0_9VIRU Orf6 OS=Propionibacterium phage B5 PE=4 SV=1
Length = 485

Score = 36.2 bits (82), Expect = 0.83
Identities = 22/67 (32%), Positives = 31/67 (46%)
Frame = -3

Query: 471 PRAVKGGLPGSEKAAGDCRRTVEAESSQRSRNGHCREFWGHEQADGGTTVEG*GAVDWRG 292
P ++G PG+ +A +R V+A S R H G + GG T+ GAV WR
Sbjct: 383 PGDLQGAAPGAWQAMPRLQRWVDAMGSVR----HALTISGGAECGGGPTINLPGAVSWRP 438

Query: 291 CIWQGSD 271
W G +
Sbjct: 439 LSWCGGE 445


>tr|A2QBQ6|A2QBQ6_ASPNC Remark: only the region of the MYND finger
domain is found in all proteins OS=Aspergillus niger
(strain CBS 513.88 / FGSC A1513) GN=An02g00880 PE=4 SV=1
Length = 922

Score = 36.2 bits (82), Expect = 0.83
Identities = 19/54 (35%), Positives = 29/54 (53%)
Frame = -3

Query: 210 RGKKDIIRRVFVCEKSRQ*SCFEKALKEISCAKRIKVHEASCYEARQISNSPSL 49
+ KK + F+C F KA +EIS KR+K+ Y+A +++ SPSL
Sbjct: 238 KAKKIVQELGFICRPLNAADTFYKAAREISNFKRVKIELLPGYKAERVAPSPSL 291


>tr|Q4S078|Q4S078_TETNG Chromosome undetermined SCAF14784, whole
genome shotgun sequence. (Fragment) OS=Tetraodon
nigroviridis GN=GSTENG00026148001 PE=4 SV=1
Length = 1085

Score = 34.7 bits (78), Expect = 2.4
Identities = 23/63 (36%), Positives = 27/63 (42%)
Frame = +2

Query: 197 SFFPLHFWNFNFRPVTCCLASSCSGSDPCHMQPLQSTAPQPSTVVPPSACSWPQNSRQWP 376
S P H + + P TC +SS S S PCH P +A Q PPS Q R P
Sbjct: 585 SLSPTHQYRHHASP-TCSPSSSSSSSSPCHSAPPPPSATQRHLSPPPSPMQ--QQQRASP 641

Query: 377 FLE 385
E
Sbjct: 642 MTE 644


>tr|B6SVR3|B6SVR3_MAIZE RKF3 OS=Zea mays PE=2 SV=1
Length = 655

Score = 34.7 bits (78), Expect = 2.4
Identities = 26/77 (33%), Positives = 38/77 (49%), Gaps = 3/77 (3%)
Frame = +1

Query: 175 HEHPSNNVFFPPALLELQLPACNVLPCFLMLRIGPLPYAAPPIYRTSTLYCSPSICLL-- 348
H HP PP + L+L +LP FL+LR P+P+A+ P + L C+ + L
Sbjct: 15 HLHP-----LPPPMCRLRL----LLPFFLLLR--PIPHASQPAAPSPALQCALNFTALLP 63

Query: 349 -MAPKLPAMAIPRALAA 396
+AP LP+ R A
Sbjct: 64 FLAPPLPSDDASRCAVA 80


>tr|Q6JRV8|Q6JRV8_XENLA RTN4.2-A2 OS=Xenopus laevis GN=RTN4 PE=2
SV=1
Length = 1044

Score = 34.3 bits (77), Expect = 3.2
Identities = 19/58 (32%), Positives = 27/58 (46%)
Frame = +2

Query: 260 SCSGSDPCHMQPLQSTAPQPSTVVPPSACSWPQNSRQWPFLERWLLSASTVLLQSPAA 433
S SGS P P + +AP PP+ C+ P +S + +L + L L PAA
Sbjct: 81 STSGSSPTPHSPPEPSAPTEEPERPPATCTAPSSSLAYTYLAQRLRKEDENLFPLPAA 138


>tr|A1WRK9|A1WRK9_VEREI UDP-N-acetylmuramoylalanine--D-glutamate
ligase OS=Verminephrobacter eiseniae (strain EF01-2)
GN=Veis_4568 PE=4 SV=1
Length = 638

Score = 33.5 bits (75), Expect = 5.4
Identities = 28/83 (33%), Positives = 36/83 (43%)
Frame = +1

Query: 184 PSNNVFFPPALLELQLPACNVLPCFLMLRIGPLPYAAPPIYRTSTLYCSPSICLLMAPKL 363
P N PPA+ Q A V F + P P A P L P+I ++ P +
Sbjct: 34 PVNPPVNPPAISAAQAAADFVAQIFASV---PAPEEAAP---AMPLAIDPAINPVINPAM 87

Query: 364 PAMAIPRALAALSLYRPSAVTRR 432
P +P ALAA L RP A R+
Sbjct: 88 PPAEVPGALAAEPLRRPGADLRQ 110