BP912415
Clone id YMU001_000018_G06
Library
Length 378
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000018_G06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGCAGGTACTCTGGGAAGCAGGTTAAGTTTCTTGTTGATGGAATGAAGAAGGAAACAGAA
GCGCATGTACACGATATAAGGCTGTCCATAAATAAGCTCAAGGTAGAGGCTCTTGAGTGC
AAAGAGAGAATTCTTGGGTTAGAGAGGTTGCTCAGAGTTAAAGAGCAATCAGACCCAAAG
AAATTGTAGAGAATTTGGACGAAGTGAGAACAAGCAGATCTCCAACATAATTTGGGCTCC
TTTATGTATCACTGATGTTGGATGTCTTTGCATGGTTAGTTGCAAGAGAACTCCAGGAGA
ATTGTATTCAACATGTGACATGCTAGTCAATGGTGGGTGCATAAAGATTGCTTGGTATGC
AGGGGAAATGCTTGGGGT
■■Homology search results ■■ -
sp_hit_id P21333
Definition sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens
Align length 31
Score (bit) 32.7
E-value 0.57
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912415|Adiantum capillus-veneris mRNA, clone:
YMU001_000018_G06.
(378 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4 33 0.57
sp|P35228|NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo sa... 30 2.8
sp|P16382|IL4RA_MOUSE Interleukin-4 receptor alpha chain OS=Mus ... 30 3.7
sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia p... 30 4.8
sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus ... 29 6.3
sp|Q96VA4|GLGB_ASPOR 1,4-alpha-glucan-branching enzyme OS=Asperg... 29 6.3
sp|O73775|FBLN1_CHICK Fibulin-1 OS=Gallus gallus GN=FBLN1 PE=2 SV=2 29 8.3
sp|P92943|CLCD_ARATH Chloride channel protein CLC-d OS=Arabidops... 29 8.3

>sp|P21333|FLNA_HUMAN Filamin-A OS=Homo sapiens GN=FLNA PE=1 SV=4
Length = 2647

Score = 32.7 bits (73), Expect = 0.57
Identities = 14/31 (45%), Positives = 21/31 (67%)
Frame = -2

Query: 152 SNLSNPRILSLHSRASTLSLFMDSLISCTCA 60
+ ++ PR++S HS T S+F+DSL TCA
Sbjct: 2514 AKVTGPRLVSNHSLHETSSVFVDSLTKATCA 2544


>sp|P35228|NOS2_HUMAN Nitric oxide synthase, inducible OS=Homo
sapiens GN=NOS2 PE=1 SV=2
Length = 1153

Score = 30.4 bits (67), Expect = 2.8
Identities = 17/43 (39%), Positives = 24/43 (55%), Gaps = 3/43 (6%)
Frame = -1

Query: 135 KNSLFALKSL---YLELIYGQPYIVYMRFCFLLHSINKKLNLL 16
K SLF LK L + ++G +Y RFC H I++KL+ L
Sbjct: 606 KKSLFMLKELNNKFRYAVFGLGSSMYPRFCAFAHDIDQKLSHL 648


>sp|P16382|IL4RA_MOUSE Interleukin-4 receptor alpha chain OS=Mus
musculus GN=Il4r PE=1 SV=1
Length = 810

Score = 30.0 bits (66), Expect = 3.7
Identities = 24/78 (30%), Positives = 33/78 (42%), Gaps = 4/78 (5%)
Frame = -2

Query: 233 KLCWRSACSHFVQILYNFFGSDCSLTLSNLSNPRILSLHSRASTLSLFMDSLISCT---C 63
+LC + S IL GS ++ L P S + R ST F+DS + C+ C
Sbjct: 3 RLCTKFLTSVGCLILLLVTGSG---SIKVLGEPTCFSDYIRTSTCEWFLDSAVDCSSQLC 59

Query: 62 ASVS-FFIPSTRNLTCFP 12
F + NLTC P
Sbjct: 60 LHYRLMFFEFSENLTCIP 77


>sp|O54705|NOS2_CAVPO Nitric oxide synthase, inducible OS=Cavia
porcellus GN=NOS2 PE=2 SV=1
Length = 1149

Score = 29.6 bits (65), Expect = 4.8
Identities = 17/43 (39%), Positives = 23/43 (53%), Gaps = 3/43 (6%)
Frame = -1

Query: 135 KNSLFALKSL---YLELIYGQPYIVYMRFCFLLHSINKKLNLL 16
K SLF LK L + ++G +Y RFC H I+ KL+ L
Sbjct: 605 KKSLFVLKKLTNTFRYAVFGLGSSMYPRFCAFAHDIDIKLSQL 647


>sp|Q90703|NOS2_CHICK Nitric oxide synthase, inducible OS=Gallus
gallus GN=NOS2 PE=2 SV=1
Length = 1136

Score = 29.3 bits (64), Expect = 6.3
Identities = 16/43 (37%), Positives = 24/43 (55%), Gaps = 3/43 (6%)
Frame = -1

Query: 135 KNSLFALKSLYLEL---IYGQPYIVYMRFCFLLHSINKKLNLL 16
KNSL LK L + ++G +Y FC H+I++KL+ L
Sbjct: 603 KNSLLTLKLLRKNIRYAVFGLGSTMYPEFCAFAHAIDQKLSQL 645


>sp|Q96VA4|GLGB_ASPOR 1,4-alpha-glucan-branching enzyme
OS=Aspergillus oryzae GN=gbeA PE=2 SV=1
Length = 689

Score = 29.3 bits (64), Expect = 6.3
Identities = 10/26 (38%), Positives = 16/26 (61%)
Frame = -1

Query: 372 SISPAYQAIFMHPPLTSMSHVEYNSP 295
S+SP Y+A+F +PP +Y+ P
Sbjct: 154 SVSPTYEAVFWNPPTEKQYKFQYSRP 179


>sp|O73775|FBLN1_CHICK Fibulin-1 OS=Gallus gallus GN=FBLN1 PE=2 SV=2
Length = 704

Score = 28.9 bits (63), Expect = 8.3
Identities = 11/21 (52%), Positives = 12/21 (57%)
Frame = +2

Query: 260 GCLCMVSCKRTPGELYSTCDM 322
G LC C+ TPG Y TC M
Sbjct: 409 GRLCAHKCENTPGSYYCTCTM 429


>sp|P92943|CLCD_ARATH Chloride channel protein CLC-d OS=Arabidopsis
thaliana GN=CLC-D PE=1 SV=2
Length = 792

Score = 28.9 bits (63), Expect = 8.3
Identities = 12/39 (30%), Positives = 22/39 (56%)
Frame = -2

Query: 125 SLHSRASTLSLFMDSLISCTCASVSFFIPSTRNLTCFPE 9
SLH + + + + +ISC +++SF +P R + PE
Sbjct: 351 SLHKKGNRVKIIEACIISCITSAISFGLPLLRKCSPCPE 389


tr_hit_id B4JXC2
Definition tr|B4JXC2|B4JXC2_DROGR GH17920 OS=Drosophila grimshawi
Align length 74
Score (bit) 36.6
E-value 0.63
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912415|Adiantum capillus-veneris mRNA, clone:
YMU001_000018_G06.
(378 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4JXC2|B4JXC2_DROGR GH17920 OS=Drosophila grimshawi GN=GH1792... 37 0.63
tr|B6LVA9|B6LVA9_BRAFL Putative uncharacterized protein (Fragmen... 32 1.5
tr|B6PZU5|B6PZU5_BRAFL Putative uncharacterized protein (Fragmen... 32 1.6
tr|Q894M7|Q894M7_CLOTE Methyl-accepting chemotaxis protein OS=Cl... 35 1.8
tr|Q6BHX6|Q6BHX6_DEBHA DEHA2G15048p OS=Debaryomyces hansenii GN=... 33 7.0
tr|Q4Q072|Q4Q072_LEIMA Amino acid permease aap11ld-like protein ... 33 7.0
tr|B4MAM0|B4MAM0_DROVI GJ15635 OS=Drosophila virilis GN=GJ15635 ... 33 7.0
tr|B0EV38|B0EV38_ENTDI Intracellular protein transport protein U... 33 9.1
tr|B0KWW5|B0KWW5_CALJA Filamin A, alpha isoform 2 (Predicted) OS... 33 9.2
tr|A9CB59|A9CB59_PAPAN Filamin A, alpha (Predicted) OS=Papio anu... 33 9.2
tr|B3NCA5|B3NCA5_DROER GG15297 OS=Drosophila erecta GN=GG15297 P... 33 9.2
tr|Q96C61|Q96C61_HUMAN FLNA protein OS=Homo sapiens PE=2 SV=1 33 9.2
tr|Q8TES4|Q8TES4_HUMAN FLJ00119 protein (Fragment) OS=Homo sapie... 33 9.2
tr|Q86TQ3|Q86TQ3_HUMAN Similar to filamin C, gamma (Actin bindin... 33 9.2
tr|Q6NXF2|Q6NXF2_HUMAN FLNA protein (Fragment) OS=Homo sapiens G... 33 9.2
tr|Q60FE6|Q60FE6_HUMAN Filamin A OS=Homo sapiens GN=FLNA PE=2 SV=1 33 9.2
tr|Q60FE5|Q60FE5_HUMAN Filamin A OS=Homo sapiens GN=FLNA PE=2 SV=1 33 9.2
tr|Q5HY55|Q5HY55_HUMAN Filamin A, alpha (Actin binding protein 2... 33 9.2
tr|Q5HY54|Q5HY54_HUMAN Filamin A, alpha (Actin binding protein 2... 33 9.2
tr|Q5HY53|Q5HY53_HUMAN Filamin A, alpha (Actin binding protein 2... 33 9.2
tr|B4E2F9|B4E2F9_HUMAN cDNA FLJ57038, highly similar to Filamin-... 33 9.2
tr|B2ZZ80|B2ZZ80_HUMAN Filamin A OS=Homo sapiens GN=FLNA PE=2 SV=1 33 9.2

>tr|B4JXC2|B4JXC2_DROGR GH17920 OS=Drosophila grimshawi GN=GH17920
PE=4 SV=1
Length = 341

Score = 36.6 bits (83), Expect = 0.63
Identities = 25/74 (33%), Positives = 35/74 (47%), Gaps = 4/74 (5%)
Frame = -2

Query: 245 IKEPKLCWRSACSHFVQILYNFFGSDCSLTLSNLS----NPRILSLHSRASTLSLFMDSL 78
I + + W +Q Y FFGS C LT ++ + +PR+LSL SR L
Sbjct: 107 IADNAIMWPQYVKDRIQSTYAFFGSSCILTAASAAAVFRSPRLLSLASRGGLL------- 159

Query: 77 ISCTCASVSFFIPS 36
TCAS++ I S
Sbjct: 160 --WTCASLALVIGS 171


>tr|B6LVA9|B6LVA9_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_213445 PE=4 SV=1
Length = 638

Score = 32.3 bits (72), Expect(2) = 1.5
Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
Frame = +1

Query: 34 VDGMKKETEAHVHDIRLSINKLKVEALECKERILGLERL-LRVKEQSD 174
+D +K+E +H+ +R S NKLK E KE LE++ L++KE +
Sbjct: 126 MDKLKEEMNSHIIKVRWSQNKLKTETEAHKETKAELEKMRLKLKEAKE 173



Score = 21.9 bits (45), Expect(2) = 1.5
Identities = 9/22 (40%), Positives = 14/22 (63%)
Frame = +2

Query: 155 ELKSNQTQRNCREFGRSENKQI 220
+LK +TQ +E RSE K++
Sbjct: 203 QLKEKETQLMMQEHQRSEEKEV 224


>tr|B6PZU5|B6PZU5_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_112968 PE=4 SV=1
Length = 296

Score = 32.3 bits (72), Expect(2) = 1.6
Identities = 18/48 (37%), Positives = 29/48 (60%), Gaps = 1/48 (2%)
Frame = +1

Query: 34 VDGMKKETEAHVHDIRLSINKLKVEALECKERILGLERL-LRVKEQSD 174
+D +K+E +H+ +R S NKLK E KE LE++ L++KE +
Sbjct: 122 MDKLKEEMNSHIIKVRWSQNKLKTETEAHKETKAELEKMRLKLKEAKE 169



Score = 21.9 bits (45), Expect(2) = 1.6
Identities = 9/22 (40%), Positives = 14/22 (63%)
Frame = +2

Query: 155 ELKSNQTQRNCREFGRSENKQI 220
+LK +TQ +E RSE K++
Sbjct: 199 QLKEKETQLMMQEHQRSEEKEV 220


>tr|Q894M7|Q894M7_CLOTE Methyl-accepting chemotaxis protein
OS=Clostridium tetani GN=CTC_01512 PE=4 SV=1
Length = 563

Score = 35.0 bits (79), Expect = 1.8
Identities = 20/59 (33%), Positives = 29/59 (49%)
Frame = +1

Query: 4 RYSGKQVKFLVDGMKKETEAHVHDIRLSINKLKVEALECKERILGLERLLRVKEQSDPK 180
+ S + L+DG+ KETE V D KLK + KE +L E ++ E+ PK
Sbjct: 428 KISSNNISVLIDGISKETENIVEDTGNIDEKLKSSSEVIKESLLSFENIILSIEEVVPK 486


>tr|Q6BHX6|Q6BHX6_DEBHA DEHA2G15048p OS=Debaryomyces hansenii
GN=DEHA2G15048g PE=4 SV=2
Length = 493

Score = 33.1 bits (74), Expect = 7.0
Identities = 20/76 (26%), Positives = 39/76 (51%), Gaps = 1/76 (1%)
Frame = +1

Query: 1 CRYSGKQVKFLVDGMKKETEAHVHDIRLSINKLKVEALECKERILGLE-RLLRVKEQSDP 177
C +GK+ + G ++TE + + I K + + +ER + E R K QS+P
Sbjct: 105 CISTGKEAN-VYHGDHEDTEVSAREYAVKIYKTSILVFKDRERYVDGEFRFRNTKNQSNP 163

Query: 178 KKL*RIWTK*EQADLQ 225
+K+ ++W + E +L+
Sbjct: 164 RKMVKVWAEKEFRNLK 179


>tr|Q4Q072|Q4Q072_LEIMA Amino acid permease aap11ld-like protein
OS=Leishmania major GN=LmjF36.6830 PE=4 SV=1
Length = 476

Score = 33.1 bits (74), Expect = 7.0
Identities = 18/51 (35%), Positives = 29/51 (56%)
Frame = -2

Query: 200 VQILYNFFGSDCSLTLSNLSNPRILSLHSRASTLSLFMDSLISCTCASVSF 48
+ + Y F G SLT +LS+ ILS ++ + L + + L+ C A+VSF
Sbjct: 312 MSVFYIFLGVMGSLTFPHLSSGNILSSYNAETDLLMMVCQLMCCFSAAVSF 362


>tr|B4MAM0|B4MAM0_DROVI GJ15635 OS=Drosophila virilis GN=GJ15635
PE=4 SV=1
Length = 337

Score = 33.1 bits (74), Expect = 7.0
Identities = 19/56 (33%), Positives = 27/56 (48%), Gaps = 4/56 (7%)
Frame = -2

Query: 245 IKEPKLCWRSACSHFVQILYNFFGSDCSLTLSNLS----NPRILSLHSRASTLSLF 90
I + + W +Q Y FFG C LT ++ + +PR+LSL SR L F
Sbjct: 103 IADNAIMWPQYVKERIQSSYAFFGGSCILTAASAAAVFRSPRLLSLASRGGLLWTF 158


>tr|B0EV38|B0EV38_ENTDI Intracellular protein transport protein
USO1, putative OS=Entamoeba dispar SAW760 GN=EDI_341030
PE=4 SV=1
Length = 1387

Score = 32.7 bits (73), Expect = 9.1
Identities = 18/54 (33%), Positives = 33/54 (61%)
Frame = +1

Query: 7 YSGKQVKFLVDGMKKETEAHVHDIRLSINKLKVEALECKERILGLERLLRVKEQ 168
Y K+++ + + M KETE + ++ +NK+K E E K +I LE +++KE+
Sbjct: 555 YKEKEIQRINEKMNKETERNNKTLQ-ELNKIKEENNEYKNQINSLEIEIKIKEE 607


>tr|B0KWW5|B0KWW5_CALJA Filamin A, alpha isoform 2 (Predicted)
OS=Callithrix jacchus GN=FLNA PE=4 SV=1
Length = 2647

Score = 32.7 bits (73), Expect = 9.2
Identities = 14/31 (45%), Positives = 21/31 (67%)
Frame = -2

Query: 152 SNLSNPRILSLHSRASTLSLFMDSLISCTCA 60
+ ++ PR++S HS T S+F+DSL TCA
Sbjct: 2514 AKVTGPRLVSNHSLHETSSVFVDSLTKATCA 2544


>tr|A9CB59|A9CB59_PAPAN Filamin A, alpha (Predicted) OS=Papio anubis
GN=FLNA PE=4 SV=1
Length = 2639

Score = 32.7 bits (73), Expect = 9.2
Identities = 14/31 (45%), Positives = 21/31 (67%)
Frame = -2

Query: 152 SNLSNPRILSLHSRASTLSLFMDSLISCTCA 60
+ ++ PR++S HS T S+F+DSL TCA
Sbjct: 2506 AKVTGPRLVSNHSLHETSSVFVDSLTKATCA 2536