BP912440
Clone id YMU001_000019_E12
Library
Length 622
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000019_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GATCCCTGTTGCTGTTTCCAACTCTTCTGAGGTCCACTTAAACGATGGCGCACATGGATC
TTCGAGTAGTCTGTCATCTGAAGAAACAACGGATGTCTCAGTAAGTACTGTCCGTCCTTC
ATTTTCTACTTGGCACTGGGAAGTCGTCGATGTCCACCTCTCCACCCTCACTTGCCGCAC
TCCCCGTGACCTGTCTACTTGCCCAGAGATGGCCCGTCTATCATAGTTTGTTAAATTGAG
CATTCCATTGCACAGGTATTGATACAGGGGGCTCTGGGGTACAGTGTTGAAATCACCAGC
CACCACAACCGGAATTCCCCCCCATGCTTGTGATAAAGAATAAGCCTTCTCCAAAAGGTG
ACGCACCTGACCAAGCTTTATGTCCCCACGGTTTGGATTAAAAAGGACATGAATATTACA
AACGACCACAAGATTGTCTTCCATCCCCTTCGGTCGCTTGCCTTTCCCTCTTTTTGGCTC
ATCACATGTAATCCGTAAGACGCAAAGCTGGGCAACATTATGCCTCAAATTAAGTTCTTG
ATACTCGATGCTTTCTTCTTGTAAAAGAACAAACTTCTTAGTCCGCCAAAAAATTGCGCA
TCCATCACTTGACCCTCCAGTG
■■Homology search results ■■ -
sp_hit_id Q0WKY2
Definition sp|Q0WKY2|CCR4E_ARATH Carbon catabolite repressor protein 4 homolog 5 OS=Arabidopsis thaliana
Align length 206
Score (bit) 152.0
E-value 1.0e-36
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912440|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_E12.
(622 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0WKY2|CCR4E_ARATH Carbon catabolite repressor protein 4 homo... 152 1e-36
sp|Q8VYU4|CCR4F_ARATH Carbon catabolite repressor protein 4 homo... 149 1e-35
sp|Q9LS39|CCR4C_ARATH Carbon catabolite repressor protein 4 homo... 137 3e-32
sp|Q5RGT6|ANGE2_DANRE Protein angel homolog 2 OS=Danio rerio GN=... 89 1e-17
sp|A6H7I3|ANGE2_BOVIN Protein angel homolog 2 OS=Bos taurus GN=A... 88 3e-17
sp|Q5VTE6|ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens GN... 87 9e-17
sp|Q8K1C0|ANGE2_MOUSE Protein angel homolog 2 OS=Mus musculus GN... 84 4e-16
sp|B2RYM0|ANGE1_RAT Protein angel homolog 1 OS=Rattus norvegicus... 83 1e-15
sp|Q8VCU0|ANGE1_MOUSE Protein angel homolog 1 OS=Mus musculus GN... 83 1e-15
sp|Q9UNK9|ANGE1_HUMAN Protein angel homolog 1 OS=Homo sapiens GN... 82 3e-15
sp|Q9ULM6|CNOT6_HUMAN CCR4-NOT transcription complex subunit 6 O... 67 7e-11
sp|Q5BJ41|CNOT6_XENLA CCR4-NOT transcription complex subunit 6 O... 65 4e-10
sp|Q6AXU9|CNOT6_RAT CCR4-NOT transcription complex subunit 6 OS=... 65 4e-10
sp|Q8K3P5|CNOT6_MOUSE CCR4-NOT transcription complex subunit 6 O... 65 4e-10
sp|Q8VEG6|CNO6L_MOUSE CCR4-NOT transcription complex subunit 6-l... 64 8e-10
sp|Q96LI5|CNO6L_HUMAN CCR4-NOT transcription complex subunit 6-l... 64 8e-10
sp|Q24239|ANGEL_DROME Protein angel OS=Drosophila melanogaster G... 64 8e-10
sp|Q4P9T3|CCR4_USTMA Glucose-repressible alcohol dehydrogenase t... 61 4e-09
sp|Q5XH73|CN6LB_XENLA CCR4-NOT transcription complex subunit 6-l... 60 7e-09
sp|A2BHJ4|CNO6L_DANRE CCR4-NOT transcription complex subunit 6-l... 60 9e-09
sp|Q6IR85|CN6LA_XENLA CCR4-NOT transcription complex subunit 6-l... 55 3e-07
sp|Q6AXQ5|PDE12_RAT 2',5'-phosphodiesterase 12 OS=Rattus norvegi... 54 5e-07
sp|Q3TIU4|PDE12_MOUSE 2',5'-phosphodiesterase 12 OS=Mus musculus... 54 8e-07
sp|Q6CEJ6|CCR4_YARLI Glucose-repressible alcohol dehydrogenase t... 52 2e-06
sp|O74874|CCR4_SCHPO Glucose-repressible alcohol dehydrogenase t... 52 2e-06
sp|A8MS41|CCR4D_ARATH Carbon catabolite repressor protein 4 homo... 52 2e-06
sp|Q6L8Q7|PDE12_HUMAN 2',5'-phosphodiesterase 12 OS=Homo sapiens... 51 4e-06
sp|Q08DF7|PDE12_BOVIN 2',5'-phosphodiesterase 12 OS=Bos taurus G... 51 4e-06
sp|Q0U7W4|CCR4_PHANO Glucose-repressible alcohol dehydrogenase t... 51 5e-06
sp|A2Q9L0|CCR4_ASPNC Glucose-repressible alcohol dehydrogenase t... 50 1e-05

>sp|Q0WKY2|CCR4E_ARATH Carbon catabolite repressor protein 4 homolog
5 OS=Arabidopsis thaliana GN=CCR4-5 PE=2 SV=2
Length = 454

Score = 152 bits (385), Expect = 1e-36
Identities = 88/206 (42%), Positives = 113/206 (54%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLRITCDEXXXXXXXXXXGM 442
TG +SDGCAIFW+ F LL + IE+ + +R+NVAQLCVL + C+E
Sbjct: 177 TGEASDGCAIFWKENLFELLDHQHIEFDKFGMRNNVAQLCVLEMNCEEDPKSKLRVRSS- 235

Query: 441 EDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPLY 262
+ +VV NIHVLFNP RGDIKLGQVR LEKAY LSQ WG IPV +AGD N+ PQS +Y
Sbjct: 236 DPRRLVVGNIHVLFNPKRGDIKLGQVRLFLEKAYKLSQEWGNIPVAIAGDLNSTPQSAIY 295

Query: 261 QYLCNGMLNLTNYDRRAISGQVDRSRGVRQVRVERWTSTTSQCQVENEGRTVLTETSVVS 82
++ + L+ +DRR ISGQ + R R S ++ S
Sbjct: 296 DFIASADLDTQLHDRRQISGQTEVEPKERSFRNHYAFSASA------------------S 337

Query: 81 SDDRLLEDPCAPSFKWTSEELETATG 4
LL + W+ EEL+ ATG
Sbjct: 338 ISGSLLNE-------WSQEELQLATG 356


>sp|Q8VYU4|CCR4F_ARATH Carbon catabolite repressor protein 4 homolog
6 OS=Arabidopsis thaliana GN=CCR4-6 PE=2 SV=2
Length = 754

Score = 149 bits (376), Expect = 1e-35
Identities = 77/172 (44%), Positives = 106/172 (61%), Gaps = 2/172 (1%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLR--ITCDEXXXXXXXXXX 448
TG + DGCAIFWR+ +F L+ EESI++ +L LR NVAQ+CVL +T
Sbjct: 261 TGNAVDGCAIFWRSNRFKLVHEESIQFNQLGLRDNVAQICVLETLLTSHTKENETPPPES 320

Query: 447 GMEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSP 268
+ VV+CNIHVLFNP RGD KLGQVR LL+KA+++S+ W P+V+ GDFN P+SP
Sbjct: 321 SAGSHRVVICNIHVLFNPKRGDFKLGQVRTLLDKAHAVSKLWDDAPIVLCGDFNCTPKSP 380

Query: 267 LYQYLCNGMLNLTNYDRRAISGQVDRSRGVRQVRVERWTSTTSQCQVENEGR 112
LY ++ + L+L+ R +SGQV S R R E +T+ +G+
Sbjct: 381 LYNFISDRKLDLSGLARDKVSGQV--SAEFRPPRPENYTTRYQSANKSPQGQ 430


>sp|Q9LS39|CCR4C_ARATH Carbon catabolite repressor protein 4 homolog
3 OS=Arabidopsis thaliana GN=CCR4-3 PE=2 SV=2
Length = 448

Score = 137 bits (346), Expect = 3e-32
Identities = 77/206 (37%), Positives = 114/206 (55%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLRITCDEXXXXXXXXXXGM 442
TG + DGCA+FW+ +F +L+ E+IE+ + +R NVAQL VL +
Sbjct: 186 TGDNVDGCAMFWKADRFGVLERENIEFSQFGMRDNVAQLAVLELRKSN------------ 233

Query: 441 EDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPLY 262
+ +++ NIHVL+NPN+GD+KLGQVR L KA+ LS+ WG IP+V+ GDFN+ P+SPLY
Sbjct: 234 KSRKILLGNIHVLYNPNQGDVKLGQVRSLCSKAHLLSKKWGDIPIVLCGDFNSTPKSPLY 293

Query: 261 QYLCNGMLNLTNYDRRAISGQVDRSRGVRQVRVERWTSTTSQCQVENEGRTVLTETSVVS 82
+L + LN+ +D++ +SGQ +N T + ET S
Sbjct: 294 NFLASSELNVMEHDKKELSGQ------------------------KNCRPTKVLETGSKS 329

Query: 81 SDDRLLEDPCAPSFKWTSEELETATG 4
S + + C+ WT EE+ ATG
Sbjct: 330 S-NTITFSFCS---SWTKEEIRVATG 351


>sp|Q5RGT6|ANGE2_DANRE Protein angel homolog 2 OS=Danio rerio
GN=angel2 PE=2 SV=1
Length = 569

Score = 89.4 bits (220), Expect = 1e-17
Identities = 59/179 (32%), Positives = 91/179 (50%), Gaps = 9/179 (5%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNL----RHNVAQLCVLRITCDEXXXXXXXX 454
TG DGCA+ ++ ++F L+ +EY + R NV + +LR
Sbjct: 279 TGLKPDGCAVIFKRERFSLVSCHPVEYFRRGVPLMDRDNVGLIVLLR-----------PI 327

Query: 453 XXGMEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGG--IPVVVAGDFNTV 280
+ + + V N H+L+NP RGDIKL Q+ LL + +SQ PV++ GDFN+V
Sbjct: 328 DPHVSLSNICVANTHLLYNPRRGDIKLAQLAMLLAEISRVSQLPDSSVCPVLLCGDFNSV 387

Query: 279 PQSPLYQYLCNGMLNLTNYDRRAISGQVDRSRGVRQVRVERWTST---TSQCQVENEGR 112
P SPLY+++ + L+ +SGQ + RG R + V W + + QCQ EN+ R
Sbjct: 388 PWSPLYRFIKDRRLDYDGMPIGKVSGQEETPRGQRILTVPIWPRSLGISQQCQYENQTR 446


>sp|A6H7I3|ANGE2_BOVIN Protein angel homolog 2 OS=Bos taurus
GN=ANGEL2 PE=2 SV=1
Length = 544

Score = 88.2 bits (217), Expect = 3e-17
Identities = 56/162 (34%), Positives = 80/162 (49%), Gaps = 6/162 (3%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNL----RHNVAQLCVLRITCDEXXXXXXXX 454
TG DGCAI ++ KF LL +E+ ++ R NV + +L+
Sbjct: 247 TGRKPDGCAICFKHSKFSLLSVNPVEFYRRDVPLLDRDNVGLVLLLQ-----------PK 295

Query: 453 XXGMEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGG--IPVVVAGDFNTV 280
+ V N H+L+NP RGDIKL Q+ LL + S++ G P+V+ GDFN+V
Sbjct: 296 IPSATSPAICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGRFCPIVMCGDFNSV 355

Query: 279 PQSPLYQYLCNGMLNLTNYDRRAISGQVDRSRGVRQVRVERW 154
P SPLY ++ G LN +SGQ SRG R + + W
Sbjct: 356 PGSPLYSFIKEGKLNYEGLAIGKVSGQEQSSRGQRILSIPIW 397


>sp|Q5VTE6|ANGE2_HUMAN Protein angel homolog 2 OS=Homo sapiens
GN=ANGEL2 PE=2 SV=1
Length = 544

Score = 86.7 bits (213), Expect = 9e-17
Identities = 56/162 (34%), Positives = 80/162 (49%), Gaps = 6/162 (3%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNL----RHNVAQLCVLRITCDEXXXXXXXX 454
TG DGCAI ++ KF LL +E+ ++ R NV + +L+
Sbjct: 247 TGRKPDGCAICFKHSKFSLLSVNPVEFFRPDISLLDRDNVGLVLLLQPKIPYAACPA--- 303

Query: 453 XXGMEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGG--IPVVVAGDFNTV 280
+ V N H+L+NP RGDIKL Q+ LL + S++ G P+V+ GDFN+V
Sbjct: 304 --------ICVANTHLLYNPRRGDIKLTQLAMLLAEISSVAHQKDGSFCPIVMCGDFNSV 355

Query: 279 PQSPLYQYLCNGMLNLTNYDRRAISGQVDRSRGVRQVRVERW 154
P SPLY ++ G LN +SGQ SRG R + + W
Sbjct: 356 PGSPLYSFIKEGKLNYEGLPIGKVSGQEQSSRGQRILSIPIW 397


>sp|Q8K1C0|ANGE2_MOUSE Protein angel homolog 2 OS=Mus musculus
GN=Angel2 PE=2 SV=1
Length = 544

Score = 84.3 bits (207), Expect = 4e-16
Identities = 52/162 (32%), Positives = 80/162 (49%), Gaps = 6/162 (3%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNL----RHNVAQLCVLRITCDEXXXXXXXX 454
TG DGCAI ++ +F LL +E+ ++ R N+ + +L+
Sbjct: 247 TGRKPDGCAICFKHSRFSLLSVNPVEFCRRDIPLLDRDNIGLVLLLQPKIPRAASPS--- 303

Query: 453 XXGMEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGG--IPVVVAGDFNTV 280
+ + N H+L+NP RGDIKL Q+ LL + +++ G P+V+ GDFN+V
Sbjct: 304 --------ICIANTHLLYNPRRGDIKLTQLAMLLAEIANVTHRKDGSSCPIVMCGDFNSV 355

Query: 279 PQSPLYQYLCNGMLNLTNYDRRAISGQVDRSRGVRQVRVERW 154
P SPLY ++ G LN +SGQ SRG R + + W
Sbjct: 356 PGSPLYSFIKEGKLNYEGLAIGKVSGQEQSSRGQRILSIPIW 397


>sp|B2RYM0|ANGE1_RAT Protein angel homolog 1 OS=Rattus norvegicus
GN=Angel1 PE=2 SV=2
Length = 667

Score = 82.8 bits (203), Expect = 1e-15
Identities = 57/175 (32%), Positives = 87/175 (49%), Gaps = 11/175 (6%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEY----QELNLRHNVAQLCVLRITCDEXXXXXXXX 454
TG +DGCA+ ++ +F LL +EY EL R NV + +L+ E
Sbjct: 322 TGCKTDGCAVCYKPTRFRLLCASPVEYFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVA 381

Query: 453 XXGMEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGG--IPVVVAGDFNTV 280
+ V N HVL+NP RGD+KL Q+ LL + +++ G P+++ GD N+V
Sbjct: 382 P-------LCVANTHVLYNPRRGDVKLAQMAILLAEVDKVARLSDGSHCPIILCGDLNSV 434

Query: 279 PQSPLYQYLCNGMLNLTNYDRRAISGQVDRSRGV--RQVRVERWTST---TSQCQ 130
P SPLY ++ +G L +SGQ D S + R+++ W S+ T CQ
Sbjct: 435 PDSPLYNFIRDGELQYNGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITDCCQ 489


>sp|Q8VCU0|ANGE1_MOUSE Protein angel homolog 1 OS=Mus musculus
GN=Angel1 PE=2 SV=2
Length = 667

Score = 82.8 bits (203), Expect = 1e-15
Identities = 57/175 (32%), Positives = 87/175 (49%), Gaps = 11/175 (6%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEY----QELNLRHNVAQLCVLRITCDEXXXXXXXX 454
TG +DGCA+ ++ +F LL +EY EL R NV + +L+ E
Sbjct: 322 TGCKTDGCAVCYKPTRFRLLCASPVEYFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVA 381

Query: 453 XXGMEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGG--IPVVVAGDFNTV 280
+ V N HVL+NP RGD+KL Q+ LL + +++ G P+++ GD N+V
Sbjct: 382 P-------LCVANTHVLYNPRRGDVKLAQMAILLAEVDKVARLSDGSHCPIILCGDLNSV 434

Query: 279 PQSPLYQYLCNGMLNLTNYDRRAISGQVDRSRGV--RQVRVERWTST---TSQCQ 130
P SPLY ++ +G L +SGQ D S + R+++ W S+ T CQ
Sbjct: 435 PDSPLYNFIRDGELQYNGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITDCCQ 489


>sp|Q9UNK9|ANGE1_HUMAN Protein angel homolog 1 OS=Homo sapiens
GN=ANGEL1 PE=1 SV=1
Length = 670

Score = 81.6 bits (200), Expect = 3e-15
Identities = 56/175 (32%), Positives = 87/175 (49%), Gaps = 11/175 (6%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEY----QELNLRHNVAQLCVLRITCDEXXXXXXXX 454
TG +DGCA+ ++ +F LL +EY EL R NV + +L+ E
Sbjct: 325 TGCKTDGCAVCYKPTRFRLLCASPVEYFRPGLELLNRDNVGLVLLLQPLVPEGLGQVSVA 384

Query: 453 XXGMEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGG--IPVVVAGDFNTV 280
+ V N H+L+NP RGD+KL Q+ LL + +++ G P+++ GD N+V
Sbjct: 385 P-------LCVANTHILYNPRRGDVKLAQMAILLAEVDKVARLSDGSHCPIILCGDLNSV 437

Query: 279 PQSPLYQYLCNGMLNLTNYDRRAISGQVDRSRGV--RQVRVERWTST---TSQCQ 130
P SPLY ++ +G L +SGQ D S + R+++ W S+ T CQ
Sbjct: 438 PDSPLYNFIRDGELQYHGMPAWKVSGQEDFSHQLYQRKLQAPLWPSSLGITDCCQ 492


tr_hit_id A7P5K3
Definition tr|A7P5K3|A7P5K3_VITVI Chromosome chr4 scaffold_6, whole genome shotgun sequence OS=Vitis vinifera
Align length 192
Score (bit) 150.0
E-value 5.0e-35
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912440|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_E12.
(622 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7P5K3|A7P5K3_VITVI Chromosome chr4 scaffold_6, whole genome ... 150 5e-35
tr|A9S9U0|A9S9U0_PHYPA Predicted protein (Fragment) OS=Physcomit... 148 2e-34
tr|B4FA09|B4FA09_MAIZE Putative uncharacterized protein OS=Zea m... 147 5e-34
tr|B8ABL5|B8ABL5_ORYSI Putative uncharacterized protein OS=Oryza... 147 7e-34
tr|A9TJL0|A9TJL0_PHYPA Predicted protein OS=Physcomitrella paten... 147 7e-34
tr|Q5ZE24|Q5ZE24_ORYSJ Endonuclease/exonuclease/phosphatase fami... 146 9e-34
tr|A7PGQ1|A7PGQ1_VITVI Chromosome chr17 scaffold_16, whole genom... 139 2e-31
tr|B4FWK3|B4FWK3_MAIZE Putative uncharacterized protein OS=Zea m... 137 4e-31
tr|A5BJE8|A5BJE8_VITVI Putative uncharacterized protein OS=Vitis... 133 7e-30
tr|Q5Z6P3|Q5Z6P3_ORYSJ Putative angel protein (Putative uncharac... 125 2e-27
tr|A2YBH3|A2YBH3_ORYSI Putative uncharacterized protein OS=Oryza... 124 3e-27
tr|A7PGS4|A7PGS4_VITVI Chromosome chr17 scaffold_16, whole genom... 112 2e-23
tr|A2ZVB0|A2ZVB0_ORYSJ Putative uncharacterized protein OS=Oryza... 101 3e-20
tr|Q4TJ86|Q4TJ86_TETNG Chromosome undetermined SCAF401, whole ge... 92 2e-17
tr|Q4SIL7|Q4SIL7_TETNG Chromosome undetermined SCAF14580, whole ... 92 2e-17
tr|A5ALC2|A5ALC2_VITVI Putative uncharacterized protein OS=Vitis... 92 3e-17
tr|Q5ZM21|Q5ZM21_CHICK Putative uncharacterized protein OS=Gallu... 90 9e-17
tr|Q5R9Y2|Q5R9Y2_PONAB Putative uncharacterized protein DKFZp469... 89 3e-16
tr|Q5ZJC6|Q5ZJC6_CHICK Putative uncharacterized protein OS=Gallu... 88 5e-16
tr|B6PK94|B6PK94_BRAFL Putative uncharacterized protein OS=Branc... 87 6e-16
tr|Q4V7L4|Q4V7L4_XENLA MGC115586 protein OS=Xenopus laevis GN=an... 87 1e-15
tr|B7Z5N3|B7Z5N3_HUMAN cDNA FLJ50627, highly similar to Homo sap... 87 1e-15
tr|B7Z2U4|B7Z2U4_HUMAN cDNA FLJ56435, highly similar to Homo sap... 87 1e-15
tr|B7Z297|B7Z297_HUMAN cDNA FLJ50488, highly similar to Homo sap... 87 1e-15
tr|B6L3F4|B6L3F4_BRAFL Putative uncharacterized protein OS=Branc... 86 1e-15
tr|Q0DD20|Q0DD20_ORYSJ Os06g0264900 protein OS=Oryza sativa subs... 82 2e-14
tr|Q01B50|Q01B50_OSTTA Endonuclease/exonuclease/phosphatase fami... 82 2e-14
tr|Q4RLU1|Q4RLU1_TETNG Chromosome 10 SCAF15019, whole genome sho... 82 3e-14
tr|A4RVW1|A4RVW1_OSTLU Predicted protein OS=Ostreococcus lucimar... 82 3e-14
tr|Q4STA1|Q4STA1_TETNG Chromosome undetermined SCAF14253, whole ... 81 6e-14

>tr|A7P5K3|A7P5K3_VITVI Chromosome chr4 scaffold_6, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00032567001
PE=4 SV=1
Length = 597

Score = 150 bits (380), Expect = 5e-35
Identities = 83/192 (43%), Positives = 109/192 (56%), Gaps = 5/192 (2%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLR-ITCDEXXXXXXXXXXG 445
TG DGCAIFWR +F LL EE IE+ +L LR NVAQ+CVL I +
Sbjct: 112 TGDPVDGCAIFWRASRFKLLHEECIEFNKLGLRDNVAQICVLESINQNYSWSTSALPASS 171

Query: 444 MEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPL 265
N VV+CNIHVL+NP RG+IKLGQVR LL+KA+++S+ W P+V+ GDFN P+SPL
Sbjct: 172 TGSNKVVICNIHVLYNPRRGEIKLGQVRALLDKAHAVSKIWNDAPIVICGDFNCTPKSPL 231

Query: 264 YQYLCNGMLNLTNYDRRAISGQVDRSRGVRQVRVERWTSTTSQCQVENEGRTVLTETSV- 88
Y ++ L+L+ DR +SGQ ++R R S + Q+ + LT V
Sbjct: 232 YNFISEQKLDLSGLDRDKVSGQAS-----AEIRAPRQFSPNPRIQLTDNSAQGLTMNDVR 286

Query: 87 ---VSSDDRLLE 61
D LLE
Sbjct: 287 EVGAKDSDSLLE 298


>tr|A9S9U0|A9S9U0_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_126290 PE=4 SV=1
Length = 347

Score = 148 bits (374), Expect = 2e-34
Identities = 74/146 (50%), Positives = 96/146 (65%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLRITCDEXXXXXXXXXXGM 442
TG S+DGCA+FWR +F LL+EE I++ E NLR NVAQLCVL C
Sbjct: 81 TGASTDGCAMFWRKNRFELLEEECIKFNEFNLRDNVAQLCVLWNNC-------------- 126

Query: 441 EDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPLY 262
VVV N H+LFNP RGD+KLGQ R LLEKA+++S+ WG PV +AGDFN+ P S LY
Sbjct: 127 ----VVVGNTHLLFNPKRGDVKLGQARVLLEKAHAISEKWGNAPVAIAGDFNSTPWSALY 182

Query: 261 QYLCNGMLNLTNYDRRAISGQVDRSR 184
+++ L+L +DRR ISGQ + ++
Sbjct: 183 RFMSCSQLDLAGHDRRNISGQEEGAK 208


>tr|B4FA09|B4FA09_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 538

Score = 147 bits (371), Expect = 5e-34
Identities = 74/146 (50%), Positives = 94/146 (64%), Gaps = 5/146 (3%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVL-----RITCDEXXXXXXX 457
TG ++DGCAIFWRT +F L EE IE+ +L LR NVAQLCVL + +
Sbjct: 270 TGDAADGCAIFWRTTRFQLRYEEDIEFTKLGLRDNVAQLCVLESVGLQYVQTDSVSLSTS 329

Query: 456 XXXGMEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVP 277
+ V++CNIHVL+NP RGDIKLGQVR LL+KA +LS+ W PV+V GDFN+ P
Sbjct: 330 SNHPQQAKQVIICNIHVLYNPKRGDIKLGQVRTLLDKANALSKMWNDAPVIVCGDFNSTP 389

Query: 276 QSPLYQYLCNGMLNLTNYDRRAISGQ 199
+SPLY ++ LNL+ R ISGQ
Sbjct: 390 KSPLYNFMLGQKLNLSGLARNTISGQ 415


>tr|B8ABL5|B8ABL5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_02823 PE=4 SV=1
Length = 903

Score = 147 bits (370), Expect = 7e-34
Identities = 68/141 (48%), Positives = 92/141 (65%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLRITCDEXXXXXXXXXXGM 442
TG ++DGCAIFWRT +F L +E IE+ +++LR NVAQ+CVL
Sbjct: 269 TGNATDGCAIFWRTARFQLRYQEDIEFNKIDLRDNVAQICVLESVIPGNVQTESSPNHPQ 328

Query: 441 EDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPLY 262
+ +VVCN HVL+NP RGDIKLGQVR LL++ Y+LS+ W PV++ GDFN+ P+SPLY
Sbjct: 329 QAKQIVVCNTHVLYNPKRGDIKLGQVRTLLDRVYALSKTWNDAPVIICGDFNSTPKSPLY 388

Query: 261 QYLCNGMLNLTNYDRRAISGQ 199
++ LNL+ + ISGQ
Sbjct: 389 NFMLEQKLNLSGLVKSNISGQ 409


>tr|A9TJL0|A9TJL0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_146589 PE=4 SV=1
Length = 372

Score = 147 bits (370), Expect = 7e-34
Identities = 72/142 (50%), Positives = 100/142 (70%), Gaps = 1/142 (0%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLRI-TCDEXXXXXXXXXXG 445
TG + DGCAIFWR +F LL+ E I++++ +LR NVAQLCVL++ +CD
Sbjct: 88 TGEAHDGCAIFWRKNRFELLEVEHIKFKDHDLRDNVAQLCVLQVLSCDS----------- 136

Query: 444 MEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPL 265
++N V+V NIHVLFNP RGD+KLGQ R LLEKA+++ + WG P+ +AGDFN+ P S L
Sbjct: 137 -KNNRVIVGNIHVLFNPKRGDVKLGQARVLLEKAHAICEKWGNAPLAIAGDFNSTPWSAL 195

Query: 264 YQYLCNGMLNLTNYDRRAISGQ 199
Y+++ + L+L +DRR ISGQ
Sbjct: 196 YEFITSSQLDLAFHDRRNISGQ 217


>tr|Q5ZE24|Q5ZE24_ORYSJ Endonuclease/exonuclease/phosphatase family
protein-like (Os01g0610600 protein) OS=Oryza sativa
subsp. japonica GN=P0410E03.25-1 PE=4 SV=1
Length = 903

Score = 146 bits (369), Expect = 9e-34
Identities = 67/141 (47%), Positives = 92/141 (65%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLRITCDEXXXXXXXXXXGM 442
TG ++DGCAIFWRT +F L +E IE+ +++LR NVAQ+CVL
Sbjct: 269 TGNATDGCAIFWRTARFQLRYQEDIEFNKIDLRDNVAQICVLESVIPGNVQTESSPNHPQ 328

Query: 441 EDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPLY 262
+ ++VCN HVL+NP RGDIKLGQVR LL++ Y+LS+ W PV++ GDFN+ P+SPLY
Sbjct: 329 QAKQIIVCNTHVLYNPKRGDIKLGQVRTLLDRVYALSKTWNDAPVIICGDFNSTPKSPLY 388

Query: 261 QYLCNGMLNLTNYDRRAISGQ 199
++ LNL+ + ISGQ
Sbjct: 389 NFMLEQKLNLSGLVKSNISGQ 409


>tr|A7PGQ1|A7PGQ1_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017640001
PE=4 SV=1
Length = 421

Score = 139 bits (349), Expect = 2e-31
Identities = 82/206 (39%), Positives = 116/206 (56%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLRITCDEXXXXXXXXXXGM 442
TG + DGCA+FW+ +KF LL+ E IE+++ LR NVAQL +
Sbjct: 166 TGDTVDGCAMFWKAEKFRLLEGECIEFKQYGLRDNVAQLSLFEA---------------- 209

Query: 441 EDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPLY 262
D ++V NIHVL+NP+RGD+KLGQ+R L +A+ LS+ WG +PVV+AGDFN+ PQS +Y
Sbjct: 210 -DVKLLVGNIHVLYNPSRGDVKLGQIRFLSSRAHILSEKWGNVPVVLAGDFNSTPQSAMY 268

Query: 261 QYLCNGMLNLTNYDRRAISGQVDRSRGVRQVRVERWTSTTSQCQVENEGRTVLTETSVVS 82
Q+L + LN+ YDRR +SGQ QV + R + + ++
Sbjct: 269 QFLSSSELNIMLYDRRELSGQ----------------RNCHPAQVFDVEREISSSFILM- 311

Query: 81 SDDRLLEDPCAPSFKWTSEELETATG 4
DR L+ C WT EE++ ATG
Sbjct: 312 --DRFLKG-C-----WTDEEVKVATG 329


>tr|B4FWK3|B4FWK3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 443

Score = 137 bits (346), Expect = 4e-31
Identities = 66/140 (47%), Positives = 95/140 (67%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLRITCDEXXXXXXXXXXGM 442
TG + DGCAIFW++K+ L++E+SI++ E NLR+NVAQ+CV +
Sbjct: 177 TGDTRDGCAIFWKSKQLHLVEEDSIDFSEFNLRNNVAQICVFELN--------------- 221

Query: 441 EDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPLY 262
+ V+ NIHVLFNP RGD+KLGQ+R LLE A +L++ W IP+V+AGDFN+ P S +Y
Sbjct: 222 GTHKFVLGNIHVLFNPKRGDVKLGQIRMLLENANALAEKWDKIPIVLAGDFNSTPDSAIY 281

Query: 261 QYLCNGMLNLTNYDRRAISG 202
++L LN++ +DRR +SG
Sbjct: 282 KFLSTMKLNISLHDRRHLSG 301


>tr|A5BJE8|A5BJE8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004443 PE=4 SV=1
Length = 559

Score = 133 bits (335), Expect = 7e-30
Identities = 79/192 (41%), Positives = 103/192 (53%), Gaps = 5/192 (2%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLR-ITCDEXXXXXXXXXXG 445
TG DGCAIFWR +F LL EE IE+ +L LR NVAQ+CVL I +
Sbjct: 51 TGDPVDGCAIFWRASRFKLLHEECIEFNKLGLRDNVAQICVLESINQNYSGSTSALPASS 110

Query: 444 MEDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPL 265
N VV+CNIHVL+NP RG+IKLGQVR LL+KA+++S+ W P+V+ GDFN P+
Sbjct: 111 TGSNKVVICNIHVLYNPRRGEIKLGQVRALLDKAHAVSKIWNDAPIVICGDFNCTPK--- 167

Query: 264 YQYLCNGMLNLTNYDRRAISGQVDRSRGVRQVRVERWTSTTSQCQVENEGRTVLTETSV- 88
L+L+ DR +SGQ ++R R S + Q+ + LT V
Sbjct: 168 --------LDLSGLDRDKVSGQAS-----AEIRAPRQFSPNPRIQLTDNSAQGLTMNDVR 214

Query: 87 ---VSSDDRLLE 61
D LLE
Sbjct: 215 EVGAKDSDSLLE 226


>tr|Q5Z6P3|Q5Z6P3_ORYSJ Putative angel protein (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=OJ1001_B06.11 PE=4 SV=1
Length = 300

Score = 125 bits (314), Expect = 2e-27
Identities = 65/140 (46%), Positives = 90/140 (64%)
Frame = -2

Query: 621 TGGSSDGCAIFWRTKKFVLLQEESIEYQELNLRHNVAQLCVLRITCDEXXXXXXXXXXGM 442
TG + DGCA FW++K LL+E+SI++ E NLR+NVAQ+ V + +
Sbjct: 169 TGDAKDGCATFWKSKGLHLLEEDSIDFSEYNLRNNVAQIFVFELNRAQK----------- 217

Query: 441 EDNLVVVCNIHVLFNPNRGDIKLGQVRHLLEKAYSLSQAWGGIPVVVAGDFNTVPQSPLY 262
+VV NIHVLFNP RGD+KLGQ+R LLEKA +L++ WGGIP+V+AGDFN+ P
Sbjct: 218 ----LVVGNIHVLFNPKRGDVKLGQIRMLLEKANALAEKWGGIPIVLAGDFNSTPD---- 269

Query: 261 QYLCNGMLNLTNYDRRAISG 202
L+++ +DRR +SG
Sbjct: 270 -------LDISLHDRRQLSG 282