BP912459
Clone id YMU001_000019_G06
Library
Length 528
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000019_G06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCAGGTACTCAACTGGAAGAATAACAGATCCATGCACATTCCAAGCATGTTGTACATTGC
TATTGCAAAACCAAATGACGTGCTCATGTGTGCCACTTGGGTATCTTCTTCTTCCCTTGA
AGCAAGGGGCAGGAACACCATGCAATGTTGTTCCCCCATTTATGTTGATCTCAACCCCAC
ACCTCTTACCTACATCAACAAGAAAAATTTAAGACCATAGAGGAAAGGTTAGCGACCAGA
AATGATAGATTCAATGTTGTATTTCTAACCTATCTCCTTGATTAACCCAAAACAACTCAC
TTTAGCCTTAGGAGGTGCTCTCCTAATGGCCCAAGTGGTCTCTGAAACTTCAGACTCCTT
TACCTGTTGTACTTTGAAGCTTGGACATTGTGGAATAGCTCTAGAGGTTGTGATGGTATT
ATATTCAGTTCTATGACTGTCAGTCTCATGAACCGGAGTAGAGTGATCCAACTTTATTTT
TCGACGCAAACTTACTTGCTCCATGGGGGGCTATCTCATGTACTCCGA
■■Homology search results ■■ -
sp_hit_id Q9NQ32
Definition sp|Q9NQ32|CK016_HUMAN Uncharacterized protein C11orf16 OS=Homo sapiens
Align length 71
Score (bit) 31.2
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912459|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_G06.
(528 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9NQ32|CK016_HUMAN Uncharacterized protein C11orf16 OS=Homo s... 31 3.2
sp|Q9VPQ6|USH_DROME Zinc finger protein ush OS=Drosophila melano... 30 9.2
sp|Q8TCZ7|CU074_HUMAN Uncharacterized protein C21orf74 OS=Homo s... 30 9.4

>sp|Q9NQ32|CK016_HUMAN Uncharacterized protein C11orf16 OS=Homo
sapiens GN=C11orf16 PE=2 SV=2
Length = 404

Score = 31.2 bits (69), Expect = 3.2
Identities = 24/71 (33%), Positives = 30/71 (42%), Gaps = 11/71 (15%)
Frame = +3

Query: 12 TGRITDP-----------CTFQACCTLLLQNQMTCSCVPLGYLLLPLKQGAGTPCNVVPP 158
TGRIT+ C ACC LL Q + C C P G PL + + +P
Sbjct: 250 TGRITNELPPDAPFLCPLCHHHACCQLLCQGCL-CGCPPCGTTWWPLTRTSEVMARELPE 308

Query: 159 FMLISTPHLLP 191
L +T LLP
Sbjct: 309 --LEATAQLLP 317


>sp|Q9VPQ6|USH_DROME Zinc finger protein ush OS=Drosophila
melanogaster GN=ush PE=1 SV=2
Length = 1191

Score = 29.6 bits (65), Expect = 9.2
Identities = 15/49 (30%), Positives = 24/49 (48%)
Frame = +3

Query: 42 QACCTLLLQNQMTCSCVPLGYLLLPLKQGAGTPCNVVPPFMLISTPHLL 188
Q C L + + S P + P GAG+ ++ PP + ++ PHLL
Sbjct: 597 QIVCAPSLPSSPSMSPSPKRRAISPRSSGAGSASSMSPPGLNVAVPHLL 645


>sp|Q8TCZ7|CU074_HUMAN Uncharacterized protein C21orf74 OS=Homo
sapiens GN=C21orf74 PE=2 SV=1
Length = 72

Score = 29.6 bits (65), Expect = 9.4
Identities = 12/33 (36%), Positives = 20/33 (60%)
Frame = -1

Query: 387 CPSFKVQQVKESEVSETTWAIRRAPPKAKVSCF 289
C +V+++ E+ S TW I+ +P KA +CF
Sbjct: 9 CLGSQVERLLEARSSRPTWIIQPSPKKAPEACF 41


tr_hit_id B5EJ51
Definition tr|B5EJ51|B5EJ51_GEOBB Cytochrome c oxidase, subunit II OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 / DSM 16622)
Align length 90
Score (bit) 35.4
E-value 1.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912459|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_G06.
(528 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B5EJ51|B5EJ51_GEOBB Cytochrome c oxidase, subunit II OS=Geoba... 35 1.8
tr|B4JRT3|B4JRT3_DROGR GH21394 OS=Drosophila grimshawi GN=GH2139... 33 9.0

>tr|B5EJ51|B5EJ51_GEOBB Cytochrome c oxidase, subunit II
OS=Geobacter bemidjiensis (strain Bem / ATCC BAA-1014 /
DSM 16622) GN=Gbem_0046 PE=4 SV=1
Length = 301

Score = 35.4 bits (80), Expect = 1.8
Identities = 26/90 (28%), Positives = 39/90 (43%), Gaps = 17/90 (18%)
Frame = -3

Query: 220 LWS*IFLVDVGKRCG---------VEININGGTTLHGVPAPCFKGRRRYPSGTHEHVIWF 68
+WS F+ D GK+ G V++N+ +HG P FK +R G HV WF
Sbjct: 102 MWSWNFVYDNGKQSGKLYVPVGRAVQVNLESKDVVHGFYVPAFKIKRDVVPGMKNHV-WF 160

Query: 67 CNSN--------VQHAWNVHGSVILPVEYL 2
++ Q+ H ++I VE L
Sbjct: 161 VATSPGTYDLFCSQYCGTGHSAMITTVEAL 190


>tr|B4JRT3|B4JRT3_DROGR GH21394 OS=Drosophila grimshawi GN=GH21394
PE=4 SV=1
Length = 395

Score = 33.1 bits (74), Expect = 9.0
Identities = 22/76 (28%), Positives = 40/76 (52%)
Frame = -1

Query: 510 PPMEQVSLRRKIKLDHSTPVHETDSHRTEYNTITTSRAIPQCPSFKVQQVKESEVSETTW 331
PP + +++ +K+ V E D +T+YN ITTS+A+ + P+ KV + K++ +T
Sbjct: 12 PPKQNIAVPQKLF------VPEGDLSQTDYNFITTSKAVVKKPA-KVSKTKKTAQKKTDK 64

Query: 330 AIRRAPPKAKVSCFGL 283
+ + K GL
Sbjct: 65 QQKTGTDEGKSDNIGL 80