BP912466
Clone id YMU001_000019_F12
Library
Length 536
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000019_F12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGAAGAGAACTGTCTATTCGTTATGTTCGAAAAAAATGCTGTACAAACTTAAAAAGCAGG
GCATGCTGGTTTATTTTGGTGGAAAGGCATCTGCAAGAGCCTTGTATCCTCGAGCTAAAA
ATAAGTGAATATACAGATTGCAATCCAACGACTAGTCCATTATGCTAAAGCCAATTGGCA
TGAGAGTGACAGAACTCTTTCTTCCATTCCAAAGAGTTACAAAGCCTAACATTGGTCTAA
GCTAAGTAGCAAAGTATTCGATGGAAAAGACGCCCCCTCGAAAAAGTATCCCTTATCATA
TGGCAGCCCTCACTGCTTCTCTTCTGATTCGAGCAGCCTTACCAGAACCTCGGAAGTACA
TATATACTTGCTTTAGAACCCACAAGCTGAGCAGGGCTTCCAAAACAAAGCAAACTGTAC
CGACAATGTAGAATGTCCCGACCAATGTCGAATCCGAAAACAAATCAATCGCAGGGAGAA
TACCCGCAAGAGATTTTCCTTTGAACACAACCGGAGGTGCTACCGCAGCAAAGATG
■■Homology search results ■■ -
sp_hit_id Q8H5X5
Definition sp|Q8H5X5|SCAM1_ORYSJ Secretory carrier-associated membrane protein 1 OS=Oryza sativa subsp. japonica
Align length 66
Score (bit) 101.0
E-value 3.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912466|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_F12.
(536 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8H5X5|SCAM1_ORYSJ Secretory carrier-associated membrane prot... 101 3e-21
sp|A2YMP7|SCAM1_ORYSI Putative secretory carrier-associated memb... 101 3e-21
sp|Q9M5P2|SCAM3_ARATH Secretory carrier-associated membrane prot... 100 3e-21
sp|Q9SXA5|SCAM5_ARATH Secretory carrier-associated membrane prot... 100 8e-21
sp|Q9SKT3|SCAM1_ARATH Secretory carrier-associated membrane prot... 99 1e-20
sp|Q9ZTX0|SCAM_PEA Secretory carrier-associated membrane protein... 93 7e-19
sp|Q6Z8F5|SCAM5_ORYSJ Secretory carrier-associated membrane prot... 93 7e-19
sp|Q60EA5|SCAM3_ORYSJ Secretory carrier-associated membrane prot... 91 3e-18
sp|Q7F613|SCAM2_ORYSJ Secretory carrier-associated membrane prot... 89 1e-17
sp|Q9LR68|SCAM2_ARATH Secretory carrier-associated membrane prot... 87 4e-17
sp|Q75IC7|SCAM4_ORYSJ Secretory carrier-associated membrane prot... 86 9e-17
sp|Q9C6X2|SCAM4_ARATH Secretory carrier-associated membrane prot... 86 9e-17
sp|Q0JAI9|SCAM6_ORYSJ Secretory carrier-associated membrane prot... 85 3e-16
sp|Q4QRK0|AMPM1_DANRE Methionine aminopeptidase 1 OS=Danio rerio... 31 3.3
sp|Q2NEW4|SYA_METST Alanyl-tRNA synthetase OS=Methanosphaera sta... 30 5.7
sp|A5E6W6|RRP3_LODEL ATP-dependent rRNA helicase RRP3 OS=Loddero... 30 7.4
sp|Q61KX5|CLAP1_CAEBR Protein CLASP-1 OS=Caenorhabditis briggsae... 30 9.7

>sp|Q8H5X5|SCAM1_ORYSJ Secretory carrier-associated membrane protein
1 OS=Oryza sativa subsp. japonica GN=SCAMP1 PE=2 SV=1
Length = 306

Score = 101 bits (251), Expect = 3e-21
Identities = 48/66 (72%), Positives = 57/66 (86%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
+F+AVAPPVVF+GKSLAGILPAIDL S + LVG FY VG F +E+LLS+WV++QVYMY
Sbjct: 224 VFSAVAPPVVFEGKSLAGILPAIDLISKNALVGIFYFVGFGLFCVESLLSIWVIQQVYMY 283

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 284 FRGSGK 289


>sp|A2YMP7|SCAM1_ORYSI Putative secretory carrier-associated
membrane protein 1 OS=Oryza sativa subsp. indica
GN=SCAMP1 PE=3 SV=1
Length = 306

Score = 101 bits (251), Expect = 3e-21
Identities = 48/66 (72%), Positives = 57/66 (86%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
+F+AVAPPVVF+GKSLAGILPAIDL S + LVG FY VG F +E+LLS+WV++QVYMY
Sbjct: 224 VFSAVAPPVVFEGKSLAGILPAIDLISKNALVGIFYFVGFGLFCVESLLSIWVIQQVYMY 283

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 284 FRGSGK 289


>sp|Q9M5P2|SCAM3_ARATH Secretory carrier-associated membrane protein
3 OS=Arabidopsis thaliana GN=SCAMP3 PE=1 SV=1
Length = 289

Score = 100 bits (250), Expect = 3e-21
Identities = 46/66 (69%), Positives = 56/66 (84%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
+FAAVAPPVVFKGKSLAGILPAID+ S +VG FY +G F LE+++S+WV++QVYMY
Sbjct: 207 VFAAVAPPVVFKGKSLAGILPAIDVLSGQAIVGIFYFIGFAFFCLESVVSIWVIQQVYMY 266

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 267 FRGSGK 272


>sp|Q9SXA5|SCAM5_ARATH Secretory carrier-associated membrane protein
5 OS=Arabidopsis thaliana GN=SCAMP5 PE=2 SV=2
Length = 291

Score = 99.8 bits (247), Expect = 8e-21
Identities = 46/66 (69%), Positives = 56/66 (84%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
+FAAVAPP+VFKGKSLAGILPAID+ S LVG FY +G F LE+++S+WV++QVYMY
Sbjct: 209 LFAAVAPPIVFKGKSLAGILPAIDVLSAQALVGIFYFIGFGLFCLESVVSIWVIQQVYMY 268

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 269 FRGSGK 274


>sp|Q9SKT3|SCAM1_ARATH Secretory carrier-associated membrane protein
1 OS=Arabidopsis thaliana GN=SCAMP1 PE=1 SV=1
Length = 282

Score = 99.4 bits (246), Expect = 1e-20
Identities = 45/66 (68%), Positives = 56/66 (84%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
+FAAVAPP++FKGKSL GILPAID+ S + LVG FY +G F LE+L+S+WV++QVYMY
Sbjct: 200 VFAAVAPPIIFKGKSLTGILPAIDVLSGNILVGIFYFIGFGFFCLESLVSIWVIQQVYMY 259

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 260 FRGSGK 265


>sp|Q9ZTX0|SCAM_PEA Secretory carrier-associated membrane protein
OS=Pisum sativum GN=PSAM2 PE=2 SV=1
Length = 289

Score = 93.2 bits (230), Expect = 7e-19
Identities = 44/66 (66%), Positives = 52/66 (78%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
I AAVAPP+VFKGKSL GIL AID+ D TLVG FY +G F LE L+S+WV++QVYM+
Sbjct: 206 ILAAVAPPIVFKGKSLTGILSAIDVVGDYTLVGIFYFIGFGFFCLETLISIWVIQQVYMH 265

Query: 355 FRGSGK 338
FRG GK
Sbjct: 266 FRGGGK 271


>sp|Q6Z8F5|SCAM5_ORYSJ Secretory carrier-associated membrane protein
5 OS=Oryza sativa subsp. japonica GN=SCAMP5 PE=2 SV=1
Length = 281

Score = 93.2 bits (230), Expect = 7e-19
Identities = 42/63 (66%), Positives = 51/63 (80%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
+FAA+APPV+F+GKSL GIL AID FSD +VG FY VG F LE L+S+WVL++VYMY
Sbjct: 217 VFAAIAPPVIFRGKSLTGILAAIDTFSDHAIVGIFYFVGFALFCLETLVSIWVLQKVYMY 276

Query: 355 FRG 347
FRG
Sbjct: 277 FRG 279


>sp|Q60EA5|SCAM3_ORYSJ Secretory carrier-associated membrane protein
3 OS=Oryza sativa subsp. japonica GN=SCAMP3 PE=2 SV=1
Length = 282

Score = 91.3 bits (225), Expect = 3e-18
Identities = 45/66 (68%), Positives = 53/66 (80%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
++AAVAPP FKGKSLAGILPAID+ S +VG FY VG F LE+LLS+ V++QVYMY
Sbjct: 200 VWAAVAPPFPFKGKSLAGILPAIDVIGRSAIVGIFYFVGFGLFCLESLLSIGVIQQVYMY 259

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 260 FRGSGK 265


>sp|Q7F613|SCAM2_ORYSJ Secretory carrier-associated membrane protein
2 OS=Oryza sativa subsp. japonica GN=SCAMP2 PE=2 SV=1
Length = 286

Score = 89.4 bits (220), Expect = 1e-17
Identities = 43/66 (65%), Positives = 54/66 (81%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
I++AVAPP FKGKSLAGILPAID+ ++ +VG FY +G F LE+LLS+ V++QVYMY
Sbjct: 204 IWSAVAPPFPFKGKSLAGILPAIDVIGNNAIVGIFYFIGFGLFCLESLLSVVVIQQVYMY 263

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 264 FRGSGK 269


>sp|Q9LR68|SCAM2_ARATH Secretory carrier-associated membrane protein
2 OS=Arabidopsis thaliana GN=SCAMP2 PE=2 SV=1
Length = 283

Score = 87.4 bits (215), Expect = 4e-17
Identities = 39/65 (60%), Positives = 50/65 (76%)
Frame = -2

Query: 532 FAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMYF 353
FAAVAPPV+F+GKSL G LPAI+L + + VG Y +G F +E LL++WV++QVY YF
Sbjct: 202 FAAVAPPVIFQGKSLTGFLPAIELLTTNAAVGIMYFIGAGFFCIETLLNIWVIQQVYAYF 261

Query: 352 RGSGK 338
RGSGK
Sbjct: 262 RGSGK 266


tr_hit_id B6TAX3
Definition tr|B6TAX3|B6TAX3_MAIZE SC3 protein OS=Zea mays
Align length 66
Score (bit) 101.0
E-value 2.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912466|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_F12.
(536 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6TAX3|B6TAX3_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 101 2e-20
tr|B7E5U7|B7E5U7_ORYSJ cDNA clone:006-207-G10, full insert seque... 101 3e-20
tr|B4FNI8|B4FNI8_MAIZE Putative uncharacterized protein OS=Zea m... 101 3e-20
tr|A7PXE4|A7PXE4_VITVI Chromosome chr12 scaffold_36, whole genom... 101 3e-20
tr|B3TLU6|B3TLU6_ELAGV Secretory carrier membrane protein OS=Ela... 100 4e-20
tr|A9PF06|A9PF06_POPTR Putative uncharacterized protein OS=Popul... 99 2e-19
tr|B7FIP0|B7FIP0_MEDTR Putative uncharacterized protein OS=Medic... 97 5e-19
tr|A9TRH7|A9TRH7_PHYPA Predicted protein OS=Physcomitrella paten... 96 1e-18
tr|A9PAD5|A9PAD5_POPTR Putative uncharacterized protein OS=Popul... 96 2e-18
tr|B7FIN0|B7FIN0_MEDTR Putative uncharacterized protein OS=Medic... 94 3e-18
tr|A9RVB1|A9RVB1_PHYPA Predicted protein OS=Physcomitrella paten... 94 4e-18
tr|A9NLD9|A9NLD9_PICSI Putative uncharacterized protein OS=Picea... 94 4e-18
tr|B7X6S6|B7X6S6_TOBAC Secretory carrier-associated membrane pro... 94 6e-18
tr|A9S5T7|A9S5T7_PHYPA Predicted protein OS=Physcomitrella paten... 94 6e-18
tr|B7EZ37|B7EZ37_ORYSJ cDNA clone:001-208-F01, full insert seque... 93 8e-18
tr|B6T3X4|B6T3X4_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 92 2e-17
tr|A9TLD7|A9TLD7_PHYPA Predicted protein OS=Physcomitrella paten... 92 2e-17
tr|B8AZR2|B8AZR2_ORYSI Putative uncharacterized protein OS=Oryza... 91 3e-17
tr|B7EVJ1|B7EVJ1_ORYSJ cDNA clone:001-022-H12, full insert seque... 91 3e-17
tr|B6TQ03|B6TQ03_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 91 3e-17
tr|B6TM90|B6TM90_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 91 4e-17
tr|B6U711|B6U711_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 90 8e-17
tr|B6TBK8|B6TBK8_MAIZE SC3 protein OS=Zea mays PE=2 SV=1 90 8e-17
tr|A7PBX6|A7PBX6_VITVI Chromosome chr2 scaffold_11, whole genome... 90 8e-17
tr|B8AAF2|B8AAF2_ORYSI Putative uncharacterized protein OS=Oryza... 89 1e-16
tr|B7EEY2|B7EEY2_ORYSJ cDNA clone:J013157H06, full insert sequen... 89 1e-16
tr|A2ZYF4|A2ZYF4_ORYSJ Putative uncharacterized protein OS=Oryza... 89 1e-16
tr|B8AL64|B8AL64_ORYSI Putative uncharacterized protein OS=Oryza... 86 9e-16
tr|A9S9K6|A9S9K6_PHYPA Predicted protein OS=Physcomitrella paten... 86 9e-16
tr|B8ATK5|B8ATK5_ORYSI Putative uncharacterized protein OS=Oryza... 85 3e-15

>tr|B6TAX3|B6TAX3_MAIZE SC3 protein OS=Zea mays PE=2 SV=1
Length = 305

Score = 101 bits (252), Expect = 2e-20
Identities = 49/66 (74%), Positives = 57/66 (86%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
+F+AVAPPVVF+GKSLAGILPAIDL S + LVG FY VG F LE+LLS+WV++QVYMY
Sbjct: 223 VFSAVAPPVVFEGKSLAGILPAIDLISVNALVGIFYFVGFGLFCLESLLSIWVIQQVYMY 282

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 283 FRGSGK 288


>tr|B7E5U7|B7E5U7_ORYSJ cDNA clone:006-207-G10, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 306

Score = 101 bits (251), Expect = 3e-20
Identities = 48/66 (72%), Positives = 57/66 (86%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
+F+AVAPPVVF+GKSLAGILPAIDL S + LVG FY VG F +E+LLS+WV++QVYMY
Sbjct: 224 VFSAVAPPVVFEGKSLAGILPAIDLISKNALVGIFYFVGFGLFCVESLLSIWVIQQVYMY 283

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 284 FRGSGK 289


>tr|B4FNI8|B4FNI8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 305

Score = 101 bits (251), Expect = 3e-20
Identities = 49/66 (74%), Positives = 56/66 (84%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
+FAAVAPP VF+GKSLAGILPAIDL S + LVG FY VG F LE+LLS+WV++QVYMY
Sbjct: 223 VFAAVAPPAVFEGKSLAGILPAIDLISVNALVGIFYFVGFGLFCLESLLSIWVIQQVYMY 282

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 283 FRGSGK 288


>tr|A7PXE4|A7PXE4_VITVI Chromosome chr12 scaffold_36, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026006001
PE=4 SV=1
Length = 285

Score = 101 bits (251), Expect = 3e-20
Identities = 47/66 (71%), Positives = 56/66 (84%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
IFA+VAPP+VFKGKSL GILPA+DL S LVG FY++G F LE+LLS+WV++QVYMY
Sbjct: 203 IFASVAPPIVFKGKSLTGILPAVDLLSKHALVGIFYLIGFGLFCLESLLSIWVVQQVYMY 262

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 263 FRGSGK 268


>tr|B3TLU6|B3TLU6_ELAGV Secretory carrier membrane protein OS=Elaeis
guineensis var. tenera PE=2 SV=1
Length = 310

Score = 100 bits (250), Expect = 4e-20
Identities = 46/66 (69%), Positives = 56/66 (84%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
I++AVAPP++FKGKSL GILPAIDL SD LVG FY +G F +E+LLS+WV++QVYMY
Sbjct: 228 IYSAVAPPIIFKGKSLTGILPAIDLISDHVLVGIFYFIGFGLFCVESLLSVWVIQQVYMY 287

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 288 FRGSGK 293


>tr|A9PF06|A9PF06_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 270

Score = 98.6 bits (244), Expect = 2e-19
Identities = 45/64 (70%), Positives = 55/64 (85%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
IFAA+APP+VF GKSL GILPA+D+FSD LVG FY+VG F LE+LLSLWVL+++YMY
Sbjct: 206 IFAAIAPPIVFHGKSLTGILPAVDVFSDHVLVGIFYLVGFGLFCLESLLSLWVLQKIYMY 265

Query: 355 FRGS 344
FRG+
Sbjct: 266 FRGN 269


>tr|B7FIP0|B7FIP0_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 311

Score = 97.1 bits (240), Expect = 5e-19
Identities = 45/66 (68%), Positives = 54/66 (81%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
I AAVAPP+VFKGKSL GIL AID+ +STL+G FY +G F LE L+S+WV++QVYMY
Sbjct: 229 ILAAVAPPIVFKGKSLTGILSAIDVIDNSTLIGIFYFIGFGFFCLETLISIWVIQQVYMY 288

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 289 FRGSGK 294


>tr|A9TRH7|A9TRH7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_197515 PE=4 SV=1
Length = 305

Score = 95.9 bits (237), Expect = 1e-18
Identities = 43/66 (65%), Positives = 54/66 (81%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
+ AA+APP+ F+GKSLAG+ PA+ LF ++ LV FY+VG V F LEALLS+WVLK+VY Y
Sbjct: 223 VLAAIAPPIFFRGKSLAGLWPALSLFGENALVAIFYVVGFVLFTLEALLSIWVLKEVYDY 282

Query: 355 FRGSGK 338
FRGSGK
Sbjct: 283 FRGSGK 288


>tr|A9PAD5|A9PAD5_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 270

Score = 95.5 bits (236), Expect = 2e-18
Identities = 44/63 (69%), Positives = 53/63 (84%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
IFAA+APP+VF GKSL GILPA+D+ SD LVG FY+VG F LE+LLSLWVL+++YMY
Sbjct: 206 IFAAIAPPIVFHGKSLTGILPAVDVISDHLLVGIFYLVGFGLFCLESLLSLWVLQKIYMY 265

Query: 355 FRG 347
FRG
Sbjct: 266 FRG 268


>tr|B7FIN0|B7FIN0_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 289

Score = 94.4 bits (233), Expect = 3e-18
Identities = 43/66 (65%), Positives = 52/66 (78%)
Frame = -2

Query: 535 IFAAVAPPVVFKGKSLAGILPAIDLFSDSTLVGTFYIVGTVCFVLEALLSLWVLKQVYMY 356
I AAVAPP+VFKGKSL GIL AID+ D T++G FY +G F LE L+S+WV++QVYMY
Sbjct: 206 ILAAVAPPIVFKGKSLTGILSAIDVIGDYTIIGIFYFIGFGLFCLETLISVWVIQQVYMY 265

Query: 355 FRGSGK 338
FRG GK
Sbjct: 266 FRGGGK 271