BP912491
Clone id YMU001_000019_B01
Library
Length 391
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000019_B01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATGGACACTGCTGGTAGGGAAACAAACTCCCATAGTCCAACCTTTTGCAGGAAGGCTCTT
GTAGGCCGTGACCTCTTCAAGTAGTTTTCTGCTTCTTTTGGTATCATCATTGTCTCCACC
AAATTGCCTTTGGCATCCTGATAAGTTCCTTGATATATCTGGAAGGAACTTGCCTGTTGT
ATCTCTGCTATAACCATGTACATGCTGGCTCCAATGTTAAGATTGTGTAAGGATCAGCAT
CATCTATTATAATTTTTGTGCTTTCTTTTTATTCCATGGAACCTGTATCCACAAGCAGTC
ATAAGGGTGAAGTTACAAGTACTCTTGCATCAAATTTGACTAACACTTTAGCATGCATGC
AGATGAGCTGATTAGTCCCTATGAAATCTGT
■■Homology search results ■■ -
sp_hit_id Q9JH67
Definition sp|Q9JH67|NS1A_OASV1 Non-structural polyprotein 1A OS=Ovine astrovirus 1
Align length 38
Score (bit) 30.0
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912491|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_B01.
(391 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9JH67|NS1A_OASV1 Non-structural polyprotein 1A OS=Ovine astr... 30 3.8
sp|Q9JH66|NS1AB_OASV1 Non-structural polyprotein 1AB OS=Ovine as... 30 3.8
sp|Q3SZ27|APOOL_BOVIN Apolipoprotein O-like OS=Bos taurus GN=APO... 30 3.8
sp|Q6UXV4|APOOL_HUMAN Apolipoprotein O-like OS=Homo sapiens GN=A... 30 4.9
sp|Q5NVS6|APOOL_PONAB Apolipoprotein O-like OS=Pongo abelii GN=A... 29 8.4

>sp|Q9JH67|NS1A_OASV1 Non-structural polyprotein 1A OS=Ovine
astrovirus 1 GN=ORF1 PE=3 SV=1
Length = 844

Score = 30.0 bits (66), Expect = 3.8
Identities = 15/38 (39%), Positives = 21/38 (55%)
Frame = -2

Query: 147 NLSGCQRQFGGDNDDTKRSRKLLEEVTAYKSLPAKGWT 34
NL G ++ G N TKR RK + YK++ KG+T
Sbjct: 634 NLGGFSQKKKGKNKSTKRKRKAVWTEEEYKAMLEKGFT 671


>sp|Q9JH66|NS1AB_OASV1 Non-structural polyprotein 1AB OS=Ovine
astrovirus 1 GN=ORF1 PE=3 SV=2
Length = 1351

Score = 30.0 bits (66), Expect = 3.8
Identities = 15/38 (39%), Positives = 21/38 (55%)
Frame = -2

Query: 147 NLSGCQRQFGGDNDDTKRSRKLLEEVTAYKSLPAKGWT 34
NL G ++ G N TKR RK + YK++ KG+T
Sbjct: 634 NLGGFSQKKKGKNKSTKRKRKAVWTEEEYKAMLEKGFT 671


>sp|Q3SZ27|APOOL_BOVIN Apolipoprotein O-like OS=Bos taurus GN=APOL
PE=2 SV=1
Length = 264

Score = 30.0 bits (66), Expect = 3.8
Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
Frame = -3

Query: 203 MYMVIAEIQQASSFQI--YQGTYQDAKGNLVETMMIPKEAENYLKRSRPTRAFLQKVGL 33
+ M A I+ +S I +G Y K +++T+ K+A YLK P R FL K+G+
Sbjct: 61 LQMGFASIRTTTSRYIGWCKGVYVFVKNGIMDTVQFGKDAYVYLK--NPPRDFLPKIGV 117


>sp|Q6UXV4|APOOL_HUMAN Apolipoprotein O-like OS=Homo sapiens
GN=APOOL PE=1 SV=1
Length = 268

Score = 29.6 bits (65), Expect = 4.9
Identities = 20/59 (33%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
Frame = -3

Query: 203 MYMVIAEIQQASSFQI--YQGTYQDAKGNLVETMMIPKEAENYLKRSRPTRAFLQKVGL 33
+ M A I+ A+ I +G Y K +++T+ K+A YLK P R FL K+G+
Sbjct: 61 LQMGFASIRTATGCYIGWCKGVYVFVKNGIMDTVQFGKDAYVYLK--NPPRDFLPKMGV 117


>sp|Q5NVS6|APOOL_PONAB Apolipoprotein O-like OS=Pongo abelii
GN=APOOL PE=2 SV=1
Length = 266

Score = 28.9 bits (63), Expect = 8.4
Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 2/59 (3%)
Frame = -3

Query: 203 MYMVIAEIQQASSFQI--YQGTYQDAKGNLVETMMIPKEAENYLKRSRPTRAFLQKVGL 33
+ M A I+ A+ I +G Y K +++T+ K+A Y+K P R FL K+G+
Sbjct: 61 LQMGFASIRTATGCYIGWCKGVYVFVKNGIMDTVQFGKDAYVYMK--NPPRDFLPKMGV 117


tr_hit_id B1VKY1
Definition tr|B1VKY1|B1VKY1_STRGG Putative FecCD-family membrane transport protein OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350)
Align length 51
Score (bit) 32.7
E-value 9.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912491|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_B01.
(391 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B1VKY1|B1VKY1_STRGG Putative FecCD-family membrane transport ... 33 9.3

>tr|B1VKY1|B1VKY1_STRGG Putative FecCD-family membrane transport
protein OS=Streptomyces griseus subsp. griseus (strain
JCM 4626 / NBRC 13350) GN=SGR_3180 PE=4 SV=1
Length = 365

Score = 32.7 bits (73), Expect = 9.3
Identities = 18/51 (35%), Positives = 27/51 (52%), Gaps = 2/51 (3%)
Frame = +3

Query: 114 LHQIAFGILISSLIYLEGTCLLYLCYNH--VHAGSNVKIV*GSASSIIIFV 260
LH+ A G+ S ++ L C++YLC V G VK++ G SS + V
Sbjct: 35 LHRRATGVAASLVVLLAAVCVVYLCVGETFVAPGEVVKVILGQPSSAELVV 85