BP912498
Clone id YMU001_000019_B11
Library
Length 530
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000019_B11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTGCCTTCTCCCCGTGCCTACAACACCCTCAGCATGCATGCTCTCCAACGCTCCACTTGC
ATCCTCGTAAGGTCAACAATTAAGAAAATGGGAGCACCCTCCAAGCTCCAAAGTATAACC
CGTTTCTTCATGAATGTCATGCGGGCTTCCACATGAAATTGTATGTACTATGCTGAGGGC
CATCTTCTTTGTGGCATCCTTCCCGGCTCTCCAAGCTTTGAGGAAGGAGGGTGGTCCCTC
TTGTTGTTAATATCCTAGGCGTGTGCATGATGCCCTCCCAAGTAGAATTGACGTTCTCAA
GTACGTGACCGACATTGAGTCCACGTGCATGTCTCATGCACCACTACTCAATTATGGTAT
TGACGAGCCCTTTTTGTGCATCCTCCTTGGCCTCCTGTGATATACCACTTAACCACTTCC
ACCCGACCCTCTCTTGTTTCCTCCATTTCCCAACGACACTTTCGGTTATGGCTTTGGCTA
GCTCCTCCTTTATTGCCTCCATGTCCATCTCCATGAACACTCCCTCTTCG
■■Homology search results ■■ -
sp_hit_id Q8NEQ5
Definition sp|Q8NEQ5|CA162_HUMAN Transmembrane protein C1orf162 OS=Homo sapiens
Align length 42
Score (bit) 30.4
E-value 5.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912498|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_B11.
(530 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8NEQ5|CA162_HUMAN Transmembrane protein C1orf162 OS=Homo sap... 30 5.5
sp|Q93Z25|PEL22_ARATH Probable pectate lyase 22 OS=Arabidopsis t... 30 7.2
sp|Q5ZK36|ING3_CHICK Inhibitor of growth protein 3 OS=Gallus gal... 30 7.2
sp|P18185|CARY_BACSU Carbamoyl-phosphate synthase arginine-speci... 30 7.2

>sp|Q8NEQ5|CA162_HUMAN Transmembrane protein C1orf162 OS=Homo
sapiens GN=C1orf162 PE=2 SV=1
Length = 155

Score = 30.4 bits (67), Expect = 5.5
Identities = 15/42 (35%), Positives = 22/42 (52%)
Frame = +3

Query: 264 CMMPSQVELTFSST*PTLSPRACLMHHYSIMVLTSPFCASSL 389
C ++ + T S+ PT SP CL +H++ L FCA L
Sbjct: 8 CKPDTERQGTLSTAAPTTSPAPCLSNHHNKKHLILAFCAGVL 49


>sp|Q93Z25|PEL22_ARATH Probable pectate lyase 22 OS=Arabidopsis
thaliana GN=At5g63180 PE=2 SV=1
Length = 432

Score = 30.0 bits (66), Expect = 7.2
Identities = 20/70 (28%), Positives = 28/70 (40%), Gaps = 4/70 (5%)
Frame = -2

Query: 307 HVLENVNSTWE----GIMHTPRILTTRGTTLLPQSLESREGCHKEDGPQHSTYNFMWKPA 140
HV+ N + WE G P I + L P S+E ED P+ N+ W+
Sbjct: 318 HVVNNDYTHWEMYAIGGSANPTINSQGNRFLAPDDSSSKEVTKHEDAPEDEWRNWNWRSE 377

Query: 139 *HS*RNGLYF 110
NG +F
Sbjct: 378 GDLLLNGAFF 387


>sp|Q5ZK36|ING3_CHICK Inhibitor of growth protein 3 OS=Gallus gallus
GN=ING3 PE=2 SV=1
Length = 417

Score = 30.0 bits (66), Expect = 7.2
Identities = 13/36 (36%), Positives = 20/36 (55%)
Frame = -1

Query: 281 LGGHHAHA*DINNKRDHPPSSKLGEPGRMPQRRWPS 174
+ HHAH+ KR H PSS G +P++++ S
Sbjct: 133 VNNHHAHSHTPVEKRKHNPSSHHGATDHVPEKKFKS 168


>sp|P18185|CARY_BACSU Carbamoyl-phosphate synthase arginine-specific
large chain OS=Bacillus subtilis GN=carB PE=3 SV=3
Length = 1030

Score = 30.0 bits (66), Expect = 7.2
Identities = 16/61 (26%), Positives = 31/61 (50%)
Frame = +3

Query: 228 RVVPLVVNILGVCMMPSQVELTFSST*PTLSPRACLMHHYSIMVLTSPFCASSLASCDIP 407
R VP+V ++GV M+P L ++ L+P + +H+ + V F + ++ D+
Sbjct: 841 RTVPVVSKVMGVPMIPLATRLLAGASLKDLNP--AVQNHHGVAVKFPVFSSHAIQDVDVK 898

Query: 408 L 410
L
Sbjct: 899 L 899


tr_hit_id A9TL62
Definition tr|A9TL62|A9TL62_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 51
Score (bit) 35.0
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912498|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_B11.
(530 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TL62|A9TL62_PHYPA Predicted protein OS=Physcomitrella paten... 35 2.4
tr|B0TDK9|B0TDK9_HELMI Putative uncharacterized protein OS=Helio... 33 9.0

>tr|A9TL62|A9TL62_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_170683 PE=4 SV=1
Length = 528

Score = 35.0 bits (79), Expect = 2.4
Identities = 17/51 (33%), Positives = 32/51 (62%)
Frame = -2

Query: 514 MEMDMEAIKEELAKAITESVVGKWRKQERVGWKWLSGISQEAKEDAQKGLV 362
+E ++A++E+L KA+TE+ V WRK+E K + +E ++ +K L+
Sbjct: 15 VEQQIDAVEEQLTKAVTEADVAYWRKKEEQLRKKEEQLRKEKEQLREKELL 65


>tr|B0TDK9|B0TDK9_HELMI Putative uncharacterized protein
OS=Heliobacterium modesticaldum (strain ATCC 51547 /
Ice1) GN=Helmi_29090 PE=4 SV=1
Length = 770

Score = 33.1 bits (74), Expect = 9.0
Identities = 13/35 (37%), Positives = 22/35 (62%)
Frame = -2

Query: 256 RILTTRGTTLLPQSLESREGCHKEDGPQHSTYNFM 152
R+ TR + L+ ++L + EGCH EDG + + +M
Sbjct: 259 RVFPTRNSDLILETLRNEEGCHVEDGERGTAVVYM 293