BP912510
Clone id YMU001_000019_C11
Library
Length 551
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000019_C11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AACTGGAAGAATTCGCGGCCAAACCACCTGTGGAACTAGCTAGAGAAGCAAAAGATGGGA
GTTTGACATTAAAATCAGCTCCAATTGAAGAAATCTGATTAGATGGACCACCCATGGAAT
GAGATGAATAGTCCTTGTATGGAGAGTGGGGATCAAAGTAGTCGAGCTCTACAACAGCTA
GAACGGTACGAACATTACCTTGTTACCTAGGTGAGAATGAAGGAAAATTGATAGTCTGAA
AAACAAAAAACTTAAATAGGCCAAAACAAACCTTGGATGTTTCTAATTTGCAATCCATTG
TGTCAACACCAATTTAGTTCACAATCACTTTGGGTGAGCTACTGAAATTATGACCACACC
TATGGAGAGATTTGCAAACCACCTTGGAAAAGATGGGATTAAAGTGAGCATCACAAATGA
ACCTGAAAAAACTCAAAACAAAGGGGCACAAACTTCTCTTGTCAACTATGTGCCCATGAA
CAAAGTATGGAATCAATGTGAAGGGAACGAGGGAAACACTACCCTTCCAGTACAGTACAA
TAATGTAACGA
■■Homology search results ■■ -
sp_hit_id Q9EPY0
Definition sp|Q9EPY0|CARD9_RAT Caspase recruitment domain-containing protein 9 OS=Rattus norvegicus
Align length 54
Score (bit) 29.6
E-value 9.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912510|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_C11.
(531 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9EPY0|CARD9_RAT Caspase recruitment domain-containing protei... 30 9.4

>sp|Q9EPY0|CARD9_RAT Caspase recruitment domain-containing protein 9
OS=Rattus norvegicus GN=Card9 PE=2 SV=1
Length = 536

Score = 29.6 bits (65), Expect = 9.4
Identities = 17/54 (31%), Positives = 25/54 (46%), Gaps = 6/54 (11%)
Frame = +3

Query: 360 HLGKDGIKVSITNEPEKTQNKGAQTSLVNYV------PMNKVWNQCEGNEGNTT 503
HL + V ++EP + + + + S NY M W Q EG+ GNTT
Sbjct: 473 HLSQTHDTVPSSSEPPEKERRRLKESFENYRRKRALRKMQNSWRQGEGDHGNTT 526


tr_hit_id B2WCT3
Definition tr|B2WCT3|B2WCT3_PYRTR Ethanolaminephosphotransferase 1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP)
Align length 125
Score (bit) 35.4
E-value 1.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912510|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_C11.
(531 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B2WCT3|B2WCT3_PYRTR Ethanolaminephosphotransferase 1 OS=Pyren... 35 1.8
tr|A6SLZ0|A6SLZ0_BOTFB Putative uncharacterized protein OS=Botry... 34 4.0

>tr|B2WCT3|B2WCT3_PYRTR Ethanolaminephosphotransferase 1
OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP)
GN=PTRG_07792 PE=4 SV=1
Length = 419

Score = 35.4 bits (80), Expect = 1.8
Identities = 33/125 (26%), Positives = 52/125 (41%), Gaps = 18/125 (14%)
Frame = -2

Query: 530 RYIIVLYWKGSVSLVPFTLIP--------YFVHGHIVDKRSLCPFVLS------FFRFIC 393
RYI+ YW G V L+P L P +F+ G++V P ++ ++ F
Sbjct: 36 RYILKHYWNGFVELLPLWLAPNLVTLLGFFFILGNVVLLELYIPDLVGPAPSWVYYSFAF 95

Query: 392 DAHFNPIFSKVVCKSLHRCGHNFSSSPKVIVN*IGVDTMDCK----LETSKVCFGLFKFF 225
V K R G +SSP + G+D+++C LET+ V +G K
Sbjct: 96 GMWMYSTMDNVDGKQARRTG---TSSPLGELFDHGIDSLNCTLASLLETAAVGYGSTKIG 152

Query: 224 VFQTI 210
F +
Sbjct: 153 AFTAL 157


>tr|A6SLZ0|A6SLZ0_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_13868
PE=4 SV=1
Length = 155

Score = 34.3 bits (77), Expect = 4.0
Identities = 23/69 (33%), Positives = 36/69 (52%), Gaps = 8/69 (11%)
Frame = +3

Query: 336 TPMERFANH-------LGKDGIKVSITNEPEKTQ-NKGAQTSLVNYVPMNKVWNQCEGNE 491
T +R+ANH +GKDG KV I EK+Q ++G L+ ++W +C G+E
Sbjct: 4 TRSKRYANHKGGRKYDVGKDGEKVEI----EKSQGHEGQADKLMASGIFKEMWERCRGHE 59

Query: 492 GNTTLPVQY 518
G L ++
Sbjct: 60 GYKALKEKF 68