BP912524
Clone id YMU001_000019_D07
Library
Length 423
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000019_D07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTTTTTTTTTTTCAATGCGCAAATATTGTATATACAATTGTGTGATGTCAATTAT
ACGAGGCATTGGGCTCAAGCTTTTGCTTCATGACCGGTGTGCAGTCATCACAACGGGTAA
TGCCAAAGATTTTTCGGGCCTGTTCATTGCATCCTCTTTTAAGTACTCAAATTCCTCATT
CGCCCTTACATCTTTGTTGCTTTTCCGACAATCAATGCTTTTCCGCCAATCAACCAAAAA
TTCAAATGCTTTCTTCAGCATTAACTTACACCTCCCCAAGGCTCAACACAGCCCTTTGTT
GAATTTGAGCTATAATCTTCAGTATTAAATGGTGATGACTTGGTTAACAGAAAATAATGC
TGTGGCATTCTCTCACCAACAATTCTTCTTCTCCCACTTCAACTCCTTGAAGTTCTCCAG
ACA
■■Homology search results ■■ -
sp_hit_id Q2GE45
Definition sp|Q2GE45|KSGA_NEOSM Dimethyladenosine transferase OS=Neorickettsia sennetsu (strain Miyayama)
Align length 91
Score (bit) 30.8
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912524|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_D07.
(406 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q2GE45|KSGA_NEOSM Dimethyladenosine transferase OS=Neorickett... 31 2.2
sp|Q08D57|SET1B_XENTR Histone-lysine N-methyltransferase SETD1B ... 29 6.3
sp|Q03055|MTV1_VIBS3 Modification methylase VspI OS=Vibrio sp. (... 29 8.2

>sp|Q2GE45|KSGA_NEOSM Dimethyladenosine transferase OS=Neorickettsia
sennetsu (strain Miyayama) GN=ksgA PE=3 SV=1
Length = 262

Score = 30.8 bits (68), Expect = 2.2
Identities = 21/91 (23%), Positives = 39/91 (42%)
Frame = +3

Query: 63 LLLHDRCAVITTGNAKDFSGLFIASSFKYSNSSFALTSLLLFRQSMLFRQSTKNSNAFFS 242
+LL + ++I+ K FS + +Y N + + LL R S LF+Q
Sbjct: 48 ILLREPASLISVEKDKRFSESLSSLMAQYQNYKYTIGDALLIRLSSLFKQE--------- 98

Query: 243 INLHLPKAQHSPLLNLSYNLQY*MVMTWLTE 335
+ + + NL YN+ +++ W+ E
Sbjct: 99 --------KVTIIANLPYNIATHLLLGWMNE 121


>sp|Q08D57|SET1B_XENTR Histone-lysine N-methyltransferase SETD1B
OS=Xenopus tropicalis GN=setd1b PE=2 SV=1
Length = 1956

Score = 29.3 bits (64), Expect = 6.3
Identities = 18/65 (27%), Positives = 34/65 (52%)
Frame = -1

Query: 208 RKSIDCRKSNKDVRANEEFEYLKEDAMNRPEKSLALPVVMTAHRS*SKSLSPMPRIIDIT 29
++++ RK N DV E E K+D +++ EK A+P+ + K+ SPM +
Sbjct: 1160 QETLHLRKKNLDVPLVESKE-CKQDTLDKVEKLFAVPMQEEVFKEHEKAPSPMNEEEEYI 1218

Query: 28 QLYIQ 14
+L ++
Sbjct: 1219 ELQLE 1223


>sp|Q03055|MTV1_VIBS3 Modification methylase VspI OS=Vibrio sp.
(strain 343) GN=vspIM PE=1 SV=1
Length = 408

Score = 28.9 bits (63), Expect = 8.2
Identities = 15/31 (48%), Positives = 19/31 (61%)
Frame = +3

Query: 90 ITTGNAKDFSGLFIASSFKYSNSSFALTSLL 182
+ TGN+KD S +F +S K NSS L LL
Sbjct: 236 LATGNSKDTSAIFFFASMKILNSSGYLGFLL 266


tr_hit_id O17617
Definition tr|O17617|O17617_CAEEL Protein C29F7.5, partially confirmed by transcript evidence OS=Caenorhabditis elegans
Align length 67
Score (bit) 34.7
E-value 2.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912524|Adiantum capillus-veneris mRNA, clone:
YMU001_000019_D07.
(406 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|O17617|O17617_CAEEL Protein C29F7.5, partially confirmed by t... 35 2.5
tr|A6LQB2|A6LQB2_CLOB8 Putative uncharacterized protein OS=Clost... 34 4.2
tr|A5B469|A5B469_VITVI Putative uncharacterized protein OS=Vitis... 33 5.5
tr|Q09CZ0|Q09CZ0_STIAU Putative uncharacterized protein OS=Stigm... 33 7.2
tr|A0M5Q5|A0M5Q5_GRAFK Putative uncharacterized protein OS=Grame... 33 7.2
tr|Q98QJ0|Q98QJ0_MYCPU LIPOPROTEIN OS=Mycoplasma pulmonis GN=MYP... 33 9.4
tr|A0CHW6|A0CHW6_PARTE Chromosome undetermined scaffold_185, who... 33 9.4

>tr|O17617|O17617_CAEEL Protein C29F7.5, partially confirmed by
transcript evidence OS=Caenorhabditis elegans GN=fkh-4
PE=2 SV=1
Length = 722

Score = 34.7 bits (78), Expect = 2.5
Identities = 21/67 (31%), Positives = 34/67 (50%), Gaps = 1/67 (1%)
Frame = +3

Query: 111 DFSGLFIASSFKYSNSSFALTSLLLFRQSMLFRQSTKNSNAFFSINLHLPKAQHSPL-LN 287
+ G+ A F+ + +F L L LF +LF + + N +F N ++ Q+SPL +
Sbjct: 269 EIDGINRAEEFEKNLYTFLLHCLELFAIILLFAMQSNDENIYFPANQYVNAGQYSPLQQS 328

Query: 288 LSYNLQY 308
S N QY
Sbjct: 329 FSQNSQY 335


>tr|A6LQB2|A6LQB2_CLOB8 Putative uncharacterized protein
OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB
8052) GN=Cbei_0354 PE=4 SV=1
Length = 570

Score = 33.9 bits (76), Expect = 4.2
Identities = 21/70 (30%), Positives = 39/70 (55%)
Frame = +3

Query: 90 ITTGNAKDFSGLFIASSFKYSNSSFALTSLLLFRQSMLFRQSTKNSNAFFSINLHLPKAQ 269
I+ GN+K FS + FK+S+ +F + + LL+ + +K+ AF + L + K
Sbjct: 149 ISDGNSKGFSLIDKDDKFKFSDQAFMMAAYLLYSHYNDSDELSKDYAAFSNEILDMFKTY 208

Query: 270 HSPLLNLSYN 299
+S L +LS++
Sbjct: 209 NSVLYDLSFS 218


>tr|A5B469|A5B469_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_037703 PE=4 SV=1
Length = 432

Score = 33.5 bits (75), Expect = 5.5
Identities = 15/26 (57%), Positives = 20/26 (76%)
Frame = +3

Query: 51 IGLKLLLHDRCAVITTGNAKDFSGLF 128
I LK +LHDR + T GNAK+F+GL+
Sbjct: 210 ISLKEVLHDRISGRTIGNAKEFNGLY 235


>tr|Q09CZ0|Q09CZ0_STIAU Putative uncharacterized protein
OS=Stigmatella aurantiaca DW4/3-1 GN=STIAU_2894 PE=4
SV=1
Length = 554

Score = 33.1 bits (74), Expect = 7.2
Identities = 22/62 (35%), Positives = 27/62 (43%), Gaps = 7/62 (11%)
Frame = +1

Query: 52 LGSSFCFMTGVQSSQRVMPKIFRACSLHPLLSTQIPHSPLHLCCF-------SDNQCFSA 210
LG S CF T QR P FR S P L + + LHL CF +DN C
Sbjct: 484 LGGSLCFRT----HQRQRPPFFRGESAAPWLPSARSFAELHLPCFLPLGPFHADNSCLRR 539

Query: 211 NQ 216
++
Sbjct: 540 SE 541


>tr|A0M5Q5|A0M5Q5_GRAFK Putative uncharacterized protein OS=Gramella
forsetii (strain KT0803) GN=GFO_3005 PE=4 SV=1
Length = 117

Score = 33.1 bits (74), Expect = 7.2
Identities = 23/74 (31%), Positives = 35/74 (47%), Gaps = 3/74 (4%)
Frame = +3

Query: 39 IIRGIGLKLLLHDRCAV---ITTGNAKDFSGLFIASSFKYSNSSFALTSLLLFRQSMLFR 209
II GI LKL +H++ V + G FS L FKYSNS + + S F+
Sbjct: 28 IIAGIKLKLEIHEKVNVYIELEKGRHITFSALMKGIKFKYSNSEH-FDKIAIVTDSNWFQ 86

Query: 210 QSTKNSNAFFSINL 251
+ S+ F +++
Sbjct: 87 NAVNVSDIFLDVDV 100


>tr|Q98QJ0|Q98QJ0_MYCPU LIPOPROTEIN OS=Mycoplasma pulmonis
GN=MYPU_3710 PE=4 SV=1
Length = 368

Score = 32.7 bits (73), Expect = 9.4
Identities = 23/75 (30%), Positives = 37/75 (49%)
Frame = -1

Query: 226 EFLVDWRKSIDCRKSNKDVRANEEFEYLKEDAMNRPEKSLALPVVMTAHRS*SKSLSPMP 47
+FL W K+I KSN D + +EF+ LK+D +K+L L +V+ +L
Sbjct: 153 KFLQSWEKTISLDKSN-DNKELKEFKKLKKDESRFFDKNLGLTLVVL------YTLIYFD 205

Query: 46 RIIDITQLYIQYLRI 2
I + YI Y+ +
Sbjct: 206 NNISLIDFYIDYINL 220


>tr|A0CHW6|A0CHW6_PARTE Chromosome undetermined scaffold_185, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00038485001 PE=4 SV=1
Length = 455

Score = 32.7 bits (73), Expect = 9.4
Identities = 22/82 (26%), Positives = 39/82 (47%), Gaps = 7/82 (8%)
Frame = +1

Query: 10 NIVYTIV*CQLYEALGSSFCFMTGVQS--SQRVMPKIFRACSLH-----PLLSTQIPHSP 168
N Y+I Q+ +G +FC++ ++ SQR +P + ++ L S + HS
Sbjct: 215 NQKYSIQITQVINQIGQAFCYLNNLKQLISQRTLPAYQQYTQIYSEIQQSLKSFEKQHSQ 274

Query: 169 LHLCCFSDNQCFSANQPKIQML 234
LH ++D Q N +I+ L
Sbjct: 275 LHQKIYNDEQIQLKNHERIKTL 296