BP912531
Clone id YMU001_000020_A06
Library
Length 306
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000020_A06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATATCTTCCAAGAATTTGAGGCAGGTGAATTGATAAGCTCCTTTATCTGCATCCCATCCT
CTTTGCAAGGCTTCATGTCGCTTAGAGCTTGGAAAAGTGGTGTAGGACTTCTTGCACACT
GGATTAGAGCAAAACACCAGTAGATCATATAAAACCATTGGATCCCAGAAATCTTTTACT
TCTTGGAACTTCGTTCCATTCCAGAAATCAATGATCCTTCTTTGAGCATCGTTTACACTT
TCACGAAGCCATTCTTGCTTATAGCGCCATACATTCAACATCTCATGACAAAATGTATTG
CATTTA
■■Homology search results ■■ -
sp_hit_id P15270
Definition sp|P15270|SP60_DICDI Spore coat protein SP60 OS=Dictyostelium discoideum
Align length 38
Score (bit) 30.0
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912531|Adiantum capillus-veneris mRNA, clone:
YMU001_000020_A06.
(306 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P15270|SP60_DICDI Spore coat protein SP60 OS=Dictyostelium di... 30 3.8
sp|Q8IZF7|GP111_HUMAN Probable G-protein coupled receptor 111 OS... 30 4.9
sp|Q9BVC3|DCC1_HUMAN Sister chromatid cohesion protein DCC1 OS=H... 30 4.9
sp|P25931|NPYR_DROME Neuropeptide Y receptor OS=Drosophila melan... 29 6.4

>sp|P15270|SP60_DICDI Spore coat protein SP60 OS=Dictyostelium
discoideum GN=cotC PE=1 SV=2
Length = 424

Score = 30.0 bits (66), Expect = 3.8
Identities = 13/38 (34%), Positives = 16/38 (42%)
Frame = -2

Query: 275 NVWRYKQEWLRESVNDAQRRIIDFWNGTKFQEVKDFWD 162
N W +W + ND D WN FQ+ D WD
Sbjct: 386 NDWDNDNDWGNDWDNDWDNEDGDNWNDDDFQDANDEWD 423


>sp|Q8IZF7|GP111_HUMAN Probable G-protein coupled receptor 111
OS=Homo sapiens GN=GPR111 PE=2 SV=1
Length = 708

Score = 29.6 bits (65), Expect = 4.9
Identities = 17/60 (28%), Positives = 30/60 (50%), Gaps = 4/60 (6%)
Frame = +1

Query: 118 TGLEQNTSRSYKTIGSQ----KSFTSWNFVPFQKSMILL*ASFTLSRSHSCL*RHTFNIS 285
TG+++ +SY TI + KS ++W F+P + S +L S + +H +IS
Sbjct: 227 TGVDEAKMQSYSTIANHILNSKSISNWTFIPDRNSSYILLHSVNSFARRLFIDKHPVDIS 286


>sp|Q9BVC3|DCC1_HUMAN Sister chromatid cohesion protein DCC1 OS=Homo
sapiens GN=DSCC1 PE=1 SV=2
Length = 393

Score = 29.6 bits (65), Expect = 4.9
Identities = 19/69 (27%), Positives = 35/69 (50%), Gaps = 4/69 (5%)
Frame = +3

Query: 90 WKSGV--GLLAHWIRAKHQ*II*NHWIPEIFYFLELRSIPEINDPSLSIVYTFTKPFLL- 260
W+ V G++ + K ++ H PEI + L++ +PE N + +++ + +
Sbjct: 292 WQQSVPEGMVTSLDQLKGLALVDRHSRPEIIFLLKVDDLPEDNQERFNSLFSLREKWTEE 351

Query: 261 -IAPYIQHL 284
IAPYIQ L
Sbjct: 352 DIAPYIQDL 360


>sp|P25931|NPYR_DROME Neuropeptide Y receptor OS=Drosophila
melanogaster GN=NepYr PE=2 SV=2
Length = 464

Score = 29.3 bits (64), Expect = 6.4
Identities = 11/29 (37%), Positives = 16/29 (55%)
Frame = +3

Query: 24 GELISSFICIPSSLQGFMSLRAWKSGVGL 110
G+++ SF C+PSS L W G+ L
Sbjct: 150 GDILMSFFCVPSSFISLFILNYWPFGLAL 178


tr_hit_id A7S850
Definition tr|A7S850|A7S850_NEMVE Predicted protein OS=Nematostella vectensis
Align length 54
Score (bit) 40.4
E-value 0.045
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912531|Adiantum capillus-veneris mRNA, clone:
YMU001_000020_A06.
(306 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7S850|A7S850_NEMVE Predicted protein OS=Nematostella vectens... 40 0.045
tr|A7SNZ4|A7SNZ4_NEMVE Predicted protein OS=Nematostella vectens... 39 0.10
tr|A7SY70|A7SY70_NEMVE Predicted protein OS=Nematostella vectens... 35 1.5
tr|A7SPB0|A7SPB0_NEMVE Predicted protein OS=Nematostella vectens... 35 1.5

>tr|A7S850|A7S850_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g208262 PE=4 SV=1
Length = 868

Score = 40.4 bits (93), Expect = 0.045
Identities = 16/54 (29%), Positives = 33/54 (61%)
Frame = -2

Query: 290 CHEMLNVWRYKQEWLRESVNDAQRRIIDFWNGTKFQEVKDFWDPMVLYDLLVFC 129
C +ML+ W+ ++ WL+ + + ++ + W+G ++ EV+ FWDP L+ + C
Sbjct: 108 CRKMLSHWQEREHWLKRNTSWPLKK--EVWDGERWLEVQWFWDPDQLWTVPTRC 159


>tr|A7SNZ4|A7SNZ4_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g246481 PE=4 SV=1
Length = 501

Score = 39.3 bits (90), Expect = 0.10
Identities = 15/48 (31%), Positives = 31/48 (64%)
Frame = -2

Query: 290 CHEMLNVWRYKQEWLRESVNDAQRRIIDFWNGTKFQEVKDFWDPMVLY 147
C +ML+ W+ ++ WL+ + + ++ + W+G ++ EV+ FWDP L+
Sbjct: 256 CRKMLSHWQEREHWLKRNTSWPLKK--EVWDGERWLEVQWFWDPDQLW 301


>tr|A7SY70|A7SY70_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g219377 PE=4 SV=1
Length = 399

Score = 35.4 bits (80), Expect = 1.5
Identities = 14/44 (31%), Positives = 26/44 (59%)
Frame = -2

Query: 290 CHEMLNVWRYKQEWLRESVNDAQRRIIDFWNGTKFQEVKDFWDP 159
C++ML+ W ++ WL V + + W+G ++ E++ FWDP
Sbjct: 38 CNKMLSHWNEREHWL--GVEQSWPIKKEMWDGERWNELQWFWDP 79


>tr|A7SPB0|A7SPB0_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g246549 PE=4 SV=1
Length = 645

Score = 35.4 bits (80), Expect = 1.5
Identities = 14/44 (31%), Positives = 26/44 (59%)
Frame = -2

Query: 290 CHEMLNVWRYKQEWLRESVNDAQRRIIDFWNGTKFQEVKDFWDP 159
C++ML+ W ++ WL V + + W+G ++ E++ FWDP
Sbjct: 38 CNKMLSHWNEREHWL--GVEQSWPIKKEMWDGERWNELQWFWDP 79