BP912560
Clone id YMU001_000020_D01
Library
Length 341
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000020_D01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGTACATAAAAGGCTACAAGGGTAGACCTTGGGCATGAGTTGCGGTGAGGCGGAAGAAGT
GGGCAAGGAACGATGGAGATATTGTCTGGAAATGTGATGACACTATCATTGGCTAGATGG
AAGCCTGAAGTGGGAGTGTGTGTGGTGTGCTGGGAATAAATACTGATACACAGGGTCAAT
GATGATGGAGCTGATGGTTATACTGTCTTGTGGATGACTACCATGAGTCTATAACTTACA
TCTTCCCTCATTAATGAAGCTGGGCTTTGCTTGAATTTATCTAGGTATGTATTGATAGAC
TCCTAACGCATTGAGTAGAGAGGGTCACATGCGTAGGGCTG
■■Homology search results ■■ -
sp_hit_id Q54KT2
Definition sp|Q54KT2|Y8896_DICDI Putative uncharacterized protein DDB_G0287191 OS=Dictyostelium discoideum
Align length 46
Score (bit) 34.3
E-value 0.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912560|Adiantum capillus-veneris mRNA, clone:
YMU001_000020_D01.
(341 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54KT2|Y8896_DICDI Putative uncharacterized protein DDB_G0287... 34 0.20
sp|Q04561|RPOA_PRRSL Replicase polyprotein 1ab OS=Porcine reprod... 29 8.3

>sp|Q54KT2|Y8896_DICDI Putative uncharacterized protein DDB_G0287191
OS=Dictyostelium discoideum GN=DDB_G0287191 PE=4 SV=1
Length = 72

Score = 34.3 bits (77), Expect = 0.20
Identities = 16/46 (34%), Positives = 22/46 (47%)
Frame = -3

Query: 168 YQYLFPAHHTHSHFRLPSSQ**CHHISRQYLHRSLPTSSASPQLMP 31
Y + +P HH H ++ S HH S + H LP+S SP P
Sbjct: 12 YHHSYPHHHHHHNYHYHSYPHHHHHHSHHHHHHHLPSSPPSPPSPP 57


>sp|Q04561|RPOA_PRRSL Replicase polyprotein 1ab OS=Porcine
reproductive and respiratory syndrome virus (strain
Lelystad) GN=rep PE=1 SV=2
Length = 3859

Score = 28.9 bits (63), Expect = 8.3
Identities = 11/19 (57%), Positives = 14/19 (73%)
Frame = -3

Query: 102 CHHISRQYLHRSLPTSSAS 46
CHHI+ +YL RSLP S +
Sbjct: 3627 CHHITSKYLPRSLPKDSVA 3645


tr_hit_id B6HG37
Definition tr|B6HG37|B6HG37_PENCH Pc20g06160 protein OS=Penicillium chrysogenum Wisconsin 54-1255
Align length 46
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912560|Adiantum capillus-veneris mRNA, clone:
YMU001_000020_D01.
(341 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6HG37|B6HG37_PENCH Pc20g06160 protein OS=Penicillium chrysog... 34 4.2
tr|Q4C0P1|Q4C0P1_CROWT RecJ exonuclease OS=Crocosphaera watsonii... 33 7.1

>tr|B6HG37|B6HG37_PENCH Pc20g06160 protein OS=Penicillium
chrysogenum Wisconsin 54-1255 GN=Pc20g06160 PE=4 SV=1
Length = 272

Score = 33.9 bits (76), Expect = 4.2
Identities = 20/46 (43%), Positives = 23/46 (50%)
Frame = -1

Query: 302 ESINTYLDKFKQSPASLMREDVSYRLMVVIHKTV*PSAPSSLTLCI 165
E I YLDK SP D SY LMV + K V PS ++L I
Sbjct: 98 EPIAMYLDKLYPSPPLFPSGDASYSLMVAVQKIVSLIRPSMVSLVI 143


>tr|Q4C0P1|Q4C0P1_CROWT RecJ exonuclease OS=Crocosphaera watsonii
GN=CwatDRAFT_2612 PE=4 SV=1
Length = 654

Score = 33.1 bits (74), Expect = 7.1
Identities = 15/46 (32%), Positives = 23/46 (50%)
Frame = -1

Query: 182 SLTLCISIYSQHTTHTPTSGFHLANDSVITFPDNISIVPCPLLPPH 45
SL C + ++ H GF L +D++I F + +S LL PH
Sbjct: 413 SLVYCYDLLGKYGGHKAAGGFGLGSDNLIAFQERLSQFAHQLLEPH 458