BP912579
Clone id YMU001_000020_E09
Library
Length 443
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000020_E09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATCTTTTCAAGGGCATTCCTTGCGAGCAAGAAGCTGCATTTCGTCCACCTTCTCAGCATC
CTCCCCAAAACCTTCTTTTCTTAAGCCATCATTTACACTTTTGTAAGTCCATGTATCTGG
ATCAAAACCTAACTCCAACATTCTTTGCAGGTATTGAAAAGCTTCCTGTGCACGGTTTAC
ACCTGCAAGATGTTTCAGCATGACCTTAAAAGTCTCTGCATGTAAGTGTTGGCCATCTTG
CAGGACCTGCTCAAAAAGTTGACACGCTTGTGCTGTTCGACCTGATACTGCATAACCAGC
AAGCAAACATTTGTAGGTTAACCAATCTGGTTCAAAACCCCTTGCATCCATTTCCAGCAT
CAAAGACTTTGCAAGTTGTGCATTTCCAGCCCTGCCGCATCCATAGATTAATGTGCTGTA
CACAATGGCATTTGGAGAGCATC
■■Homology search results ■■ -
sp_hit_id O49436
Definition sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein At4g20090 OS=Arabidopsis thaliana
Align length 120
Score (bit) 77.4
E-value 2.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912579|Adiantum capillus-veneris mRNA, clone:
YMU001_000020_E09.
(443 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protei... 77 2e-14
sp|P0C7R3|PP106_ARATH Pentatricopeptide repeat-containing protei... 75 1e-13
sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protei... 75 2e-13
sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protei... 74 2e-13
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protei... 74 3e-13
sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protei... 73 5e-13
sp|Q9M1D8|PP288_ARATH Pentatricopeptide repeat-containing protei... 73 5e-13
sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protei... 72 1e-12
sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protei... 71 2e-12
sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protei... 71 2e-12
sp|Q9LFF1|PP281_ARATH Pentatricopeptide repeat-containing protei... 71 2e-12
sp|Q9FH87|PP447_ARATH Putative pentatricopeptide repeat-containi... 69 7e-12
sp|Q9FFE3|PP388_ARATH Pentatricopeptide repeat-containing protei... 69 9e-12
sp|Q9LER0|PP381_ARATH Pentatricopeptide repeat-containing protei... 69 9e-12
sp|Q8VZE4|PP299_ARATH Pentatricopeptide repeat-containing protei... 69 9e-12
sp|Q6NQ83|PP247_ARATH Pentatricopeptide repeat-containing protei... 69 1e-11
sp|Q9SAJ5|PP133_ARATH Pentatricopeptide repeat-containing protei... 69 1e-11
sp|Q9CA58|PP120_ARATH Putative pentatricopeptide repeat-containi... 69 1e-11
sp|Q9ZQF1|PP152_ARATH Pentatricopeptide repeat-containing protei... 68 1e-11
sp|Q9SFV9|PP218_ARATH Pentatricopeptide repeat-containing protei... 68 2e-11
sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protei... 67 3e-11
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protei... 67 3e-11
sp|Q76C99|RF1_ORYSI Protein Rf1, mitochondrial OS=Oryza sativa s... 67 3e-11
sp|Q9LQ16|PPR94_ARATH Pentatricopeptide repeat-containing protei... 67 3e-11
sp|Q84J71|PP161_ARATH Pentatricopeptide repeat-containing protei... 67 3e-11
sp|Q9FX35|PP117_ARATH Pentatricopeptide repeat-containing protei... 67 3e-11
sp|Q9LQ15|PPR95_ARATH Pentatricopeptide repeat-containing protei... 67 4e-11
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protei... 67 4e-11
sp|Q9SZ20|PP339_ARATH Pentatricopeptide repeat-containing protei... 67 4e-11
sp|Q9LQ14|PPR96_ARATH Pentatricopeptide repeat-containing protei... 66 6e-11

>sp|O49436|PP327_ARATH Pentatricopeptide repeat-containing protein
At4g20090 OS=Arabidopsis thaliana GN=EMB1025 PE=2 SV=1
Length = 660

Score = 77.4 bits (189), Expect = 2e-14
Identities = 41/120 (34%), Positives = 64/120 (53%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C PN +VYS L+ G R G AK ++ M A G P+ TY L+ G+ +G +A
Sbjct: 393 CKPNIVVYSVLVDGLCREGKPNEAKEILNRMIASGCLPNAYTYSSLMKGFFKTGLCEEAV 452

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
Q+++++ + G + + V++ L GV R +EA +ML +G PDT Y S+ GL
Sbjct: 453 QVWKEMDKTGCSRNKFCYSVLIDGLCGVGRVKEAMMVWSKMLTIGIKPDTVAYSSIIKGL 512



Score = 70.1 bits (170), Expect = 4e-12
Identities = 40/132 (30%), Positives = 66/132 (50%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C PN + Y+TLI+G G A SL+ M + P+ +TY L+ G R A
Sbjct: 288 CVPNEVTYNTLIHGLCLKGKLDKAVSLLERMVSSKCIPNDVTYGTLINGLVKQRRATDAV 347

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+L + + G HL+ + V++ L +A+EA ++M E G P+ Y + DGL
Sbjct: 348 RLLSSMEERGYHLNQHIYSVLISGLFKEGKAEEAMSLWRKMAEKGCKPNIVVYSVLVDGL 407

Query: 81 RKEGFGEDAEKV 46
+EG +A+++
Sbjct: 408 CREGKPNEAKEI 419



Score = 67.0 bits (162), Expect = 3e-11
Identities = 39/132 (29%), Positives = 65/132 (49%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C PN + Y TLI G + A A L+ M+ RG+ + Y L++G G+ +A
Sbjct: 323 CIPNDVTYGTLINGLVKQRRATDAVRLLSSMEERGYHLNQHIYSVLISGLFKEGKAEEAM 382

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
L+ ++ + G + + V++ L + EA + L RM+ G P+ +TY S+ G
Sbjct: 383 SLWRKMAEKGCKPNIVVYSVLVDGLCREGKPNEAKEILNRMIASGCLPNAYTYSSLMKGF 442

Query: 81 RKEGFGEDAEKV 46
K G E+A +V
Sbjct: 443 FKTGLCEEAVQV 454



Score = 62.8 bits (151), Expect = 6e-10
Identities = 40/143 (27%), Positives = 70/143 (48%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
CSP+ ++Y+ LI G + G+ L+ M +G P+ +TY L+ G + G+ +A
Sbjct: 253 CSPSPVIYNVLIDGLCKKGDLTRVTKLVDNMFLKGCVPNEVTYNTLIHGLCLKGKLDKAV 312

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
L E+++ + T+ ++ L RA +A + L M E G+ + Y + GL
Sbjct: 313 SLLERMVSSKCIPNDVTYGTLINGLVKQRRATDAVRLLSSMEERGYHLNQHIYSVLISGL 372

Query: 81 RKEGFGEDAEKVDEMQLLARKEC 13
KEG E+A + + +A K C
Sbjct: 373 FKEGKAEEAMSL--WRKMAEKGC 393



Score = 53.9 bits (128), Expect = 3e-07
Identities = 36/123 (29%), Positives = 54/123 (43%), Gaps = 3/123 (2%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C PNA YS+L+ G + G + A + EMD G + Y L+ G GR +A
Sbjct: 428 CLPNAYTYSSLMKGFFKTGLCEEAVQVWKEMDKTGCSRNKFCYSVLIDGLCGVGRVKEAM 487

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRML---ELGFDPDTWTYKSVN 91
++ ++L G + ++K L G+ A + ML E PD TY +
Sbjct: 488 MVWSKMLTIGIKPDTVAYSSIIKGLCGIGSMDAALKLYHEMLCQEEPKSQPDVVTYNILL 547

Query: 90 DGL 82
DGL
Sbjct: 548 DGL 550



Score = 32.7 bits (73), Expect = 0.69
Identities = 21/71 (29%), Positives = 33/71 (46%), Gaps = 3/71 (4%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEM---DARGFEPDWLTYKCLLAGYAVSGRTAQA 265
P+ + YS++I G G+ A L EM + +PD +TY LL G + ++A
Sbjct: 500 PDTVAYSSIIKGLCGIGSMDAALKLYHEMLCQEEPKSQPDVVTYNILLDGLCMQKDISRA 559

Query: 264 CQLFEQVLQDG 232
L +L G
Sbjct: 560 VDLLNSMLDRG 570



Score = 31.2 bits (69), Expect = 2.0
Identities = 20/62 (32%), Positives = 32/62 (51%)
Frame = -3

Query: 213 TFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKEGFGEDAEKVDEMQ 34
+F +++K L + A + + M E PD +TY ++ DGL KE E++DE
Sbjct: 189 SFNLVIKALCKLRFVDRAIEVFRGMPERKCLPDGYTYCTLMDGLCKE------ERIDEAV 242

Query: 33 LL 28
LL
Sbjct: 243 LL 244


>sp|P0C7R3|PP106_ARATH Pentatricopeptide repeat-containing protein
At1g64585, mitochondrial OS=Arabidopsis thaliana
GN=At1g64585 PE=2 SV=1
Length = 512

Score = 75.1 bits (183), Expect = 1e-13
Identities = 44/141 (31%), Positives = 70/141 (49%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN +VY+TLI G + G +A L+ EM+ +G D +TY LL G SGR + A ++
Sbjct: 174 PNVVVYNTLIDGLCKNGELNIALELLNEMEKKGLGADVVTYNTLLTGLCYSGRWSDAARM 233

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
+++ + TF ++ EA + + M++ DP+ TY S+ +GL
Sbjct: 234 LRDMMKRSINPDVVTFTALIDVFVKQGNLDEAQELYKEMIQSSVDPNNVTYNSIINGLCM 293

Query: 75 EGFGEDAEKVDEMQLLARKEC 13
G DA+K L+A K C
Sbjct: 294 HGRLYDAKKT--FDLMASKGC 312



Score = 57.0 bits (136), Expect = 3e-08
Identities = 33/125 (26%), Positives = 64/125 (51%)
Frame = -3

Query: 420 YSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQVL 241
Y+TLI+G + G ++A + M +R PD +T+ LL G V+G A F+ +
Sbjct: 354 YNTLIHGYCQVGKLRVALDIFCWMVSRRVTPDIITHCILLHGLCVNGEIESALVKFDDMR 413

Query: 240 QDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKEGFGE 61
+ +++ + +M+ L ++ ++A++ R+ G PD TY + GL K G
Sbjct: 414 ESEKYIGIVAYNIMIHGLCKADKVEKAWELFCRLPVEGVKPDARTYTIMILGLCKNGPRR 473

Query: 60 DAEKV 46
+A+++
Sbjct: 474 EADEL 478



Score = 52.4 bits (124), Expect = 8e-07
Identities = 31/130 (23%), Positives = 65/130 (50%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + + +L++G A SL++ M G+EP+ + Y L+ G +G A +L
Sbjct: 139 PSIVTFGSLLHGFCLVNRIGDAFSLVILMVKSGYEPNVVVYNTLIDGLCKNGELNIALEL 198

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
++ + G T+ +L L R +A + L+ M++ +PD T+ ++ D K
Sbjct: 199 LNEMEKKGLGADVVTYNTLLTGLCYSGRWSDAARMLRDMMKRSINPDVVTFTALIDVFVK 258

Query: 75 EGFGEDAEKV 46
+G ++A+++
Sbjct: 259 QGNLDEAQEL 268



Score = 51.2 bits (121), Expect = 2e-06
Identities = 30/123 (24%), Positives = 56/123 (45%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
+P+ + ++ LI + GN A+ L EM +P+ +TY ++ G + GR A +
Sbjct: 243 NPDVVTFTALIDVFVKQGNLDEAQELYKEMIQSSVDPNNVTYNSIINGLCMHGRLYDAKK 302

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
F+ + G + T+ ++ E + QRM GF+ D +TY ++ G
Sbjct: 303 TFDLMASKGCFPNVVTYNTLISGFCKFRMVDEGMKLFQRMSCEGFNADIFTYNTLIHGYC 362

Query: 78 KEG 70
+ G
Sbjct: 363 QVG 365



Score = 47.0 bits (110), Expect = 4e-05
Identities = 34/141 (24%), Positives = 63/141 (44%), Gaps = 1/141 (0%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
+ + Y+TL+ G +G A ++ +M R PD +T+ L+ + G +A +L+
Sbjct: 210 DVVTYNTLLTGLCYSGRWSDAARMLRDMMKRSINPDVVTFTALIDVFVKQGNLDEAQELY 269

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKE 73
++++Q + T+ ++ L R +A + M G P+ TY ++ G K
Sbjct: 270 KEMIQSSVDPNNVTYNSIINGLCMHGRLYDAKKTFDLMASKGCFPNVVTYNTLISGFCK- 328

Query: 72 GFGEDAEKVDE-MQLLARKEC 13
VDE M+L R C
Sbjct: 329 -----FRMVDEGMKLFQRMSC 344



Score = 43.5 bits (101), Expect = 4e-04
Identities = 33/135 (24%), Positives = 61/135 (45%), Gaps = 1/135 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN + Y+++I G G AK M ++G P+ +TY L++G+ + +L
Sbjct: 279 PNNVTYNSIINGLCMHGRLYDAKKTFDLMASKGCFPNVVTYNTLISGFCKFRMVDEGMKL 338

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F+++ +G + T+ ++ V + + A M+ PD T+ + GL
Sbjct: 339 FQRMSCEGFNADIFTYNTLIHGYCQVGKLRVALDIFCWMVSRRVTPDIITHCILLHGLCV 398

Query: 75 EGFGEDA-EKVDEMQ 34
G E A K D+M+
Sbjct: 399 NGEIESALVKFDDMR 413



Score = 40.8 bits (94), Expect = 0.003
Identities = 26/122 (21%), Positives = 54/122 (44%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + ++ L+ + +M+ G D ++ L+ + R + A +
Sbjct: 69 PSIVDFTRLLTATANLRRYETVIYFSQKMELYGISHDLYSFTILIHCFCRCSRLSFALSV 128

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
++++ G TF +L VNR +AF + M++ G++P+ Y ++ DGL K
Sbjct: 129 LGKMMKLGYEPSIVTFGSLLHGFCLVNRIGDAFSLVILMVKSGYEPNVVVYNTLIDGLCK 188

Query: 75 EG 70
G
Sbjct: 189 NG 190



Score = 36.2 bits (82), Expect = 0.063
Identities = 16/65 (24%), Positives = 33/65 (50%)
Frame = -3

Query: 426 IVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQ 247
+ Y+ +I+G +A + A L + G +PD TY ++ G +G +A +L +
Sbjct: 422 VAYNIMIHGLCKADKVEKAWELFCRLPVEGVKPDARTYTIMILGLCKNGPRREADELIRR 481

Query: 246 VLQDG 232
+ ++G
Sbjct: 482 MKEEG 486


>sp|Q9T0D6|PP306_ARATH Pentatricopeptide repeat-containing protein
At4g11690 OS=Arabidopsis thaliana GN=At4g11690 PE=2 SV=1
Length = 566

Score = 74.7 bits (182), Expect = 2e-13
Identities = 44/136 (32%), Positives = 71/136 (52%), Gaps = 1/136 (0%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SPN ++Y+TLI GC + G + AK L EM G + TY L+ G +G Q +
Sbjct: 195 SPNVVIYTTLIDGCCKKGEIEKAKDLFFEMGKLGLVANERTYTVLINGLFKNGVKKQGFE 254

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
++E++ +DG + T+ ++ L R ++AFQ M E G + TY ++ GL
Sbjct: 255 MYEKMQEDGVFPNLYTYNCVMNQLCKDGRTKDAFQVFDEMRERGVSCNIVTYNTLIGGLC 314

Query: 78 KEGFGEDAEK-VDEMQ 34
+E +A K VD+M+
Sbjct: 315 REMKLNEANKVVDQMK 330



Score = 65.1 bits (157), Expect = 1e-10
Identities = 40/142 (28%), Positives = 70/142 (49%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
+PN I Y+TLI G G A SL ++ +RG P +TY L++G+ G T+ A +
Sbjct: 335 NPNLITYNTLIDGFCGVGKLGKALSLCRDLKSRGLSPSLVTYNILVSGFCRKGDTSGAAK 394

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
+ +++ + G T+ +++ A + ++A Q M ELG PD TY + G
Sbjct: 395 MVKEMEERGIKPSKVTYTILIDTFARSDNMEKAIQLRLSMEELGLVPDVHTYSVLIHGFC 454

Query: 78 KEGFGEDAEKVDEMQLLARKEC 13
+G +A ++ + + K C
Sbjct: 455 IKGQMNEASRL--FKSMVEKNC 474



Score = 61.2 bits (147), Expect = 2e-09
Identities = 39/130 (30%), Positives = 68/130 (52%), Gaps = 1/130 (0%)
Frame = -3

Query: 420 YSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQVL 241
+ LI GC AG + + L++E+ GF P+ + Y L+ G G +A LF ++
Sbjct: 166 FGILIKGCCEAGEIEKSFDLLIELTEFGFSPNVVIYTTLIDGCCKKGEIEKAKDLFFEMG 225

Query: 240 QDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKEGFGE 61
+ G + T+ V++ L ++ F+ ++M E G P+ +TY V + L K+G +
Sbjct: 226 KLGLVANERTYTVLINGLFKNGVKKQGFEMYEKMQEDGVFPNLYTYNCVMNQLCKDGRTK 285

Query: 60 DAEKV-DEMQ 34
DA +V DEM+
Sbjct: 286 DAFQVFDEMR 295



Score = 54.7 bits (130), Expect = 2e-07
Identities = 36/131 (27%), Positives = 63/131 (48%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ + Y+ L+ G R G+ A ++ EM+ RG +P +TY L+ +A S +A Q
Sbjct: 370 SPSLVTYNILVSGFCRKGDTSGAAKMVKEMEERGIKPSKVTYTILIDTFARSDNMEKAIQ 429

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
L + + G T+ V++ + EA + + M+E +P+ Y ++ G
Sbjct: 430 LRLSMEELGLVPDVHTYSVLIHGFCIKGQMNEASRLFKSMVEKNCEPNEVIYNTMILGYC 489

Query: 78 KEGFGEDAEKV 46
KEG A K+
Sbjct: 490 KEGSSYRALKL 500



Score = 52.0 bits (123), Expect = 1e-06
Identities = 27/108 (25%), Positives = 56/108 (51%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ YS LI+G G A L M + EP+ + Y ++ GY G + +A +L
Sbjct: 441 PDVHTYSVLIHGFCIKGQMNEASRLFKSMVEKNCEPNEVIYNTMILGYCKEGSSYRALKL 500

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDT 112
+++ + + +++ M++ L +++EA + +++M++ G DP T
Sbjct: 501 LKEMEEKELAPNVASYRYMIEVLCKERKSKEAERLVEKMIDSGIDPST 548



Score = 45.8 bits (107), Expect = 8e-05
Identities = 32/135 (23%), Positives = 60/135 (44%), Gaps = 1/135 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN Y+ ++ + G + A + EM RG + +TY L+ G + +A ++
Sbjct: 266 PNLYTYNCVMNQLCKDGRTKDAFQVFDEMRERGVSCNIVTYNTLIGGLCREMKLNEANKV 325

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
+Q+ DG + + T+ ++ GV + +A + + G P TY + G +
Sbjct: 326 VDQMKSDGINPNLITYNTLIDGFCGVGKLGKALSLCRDLKSRGLSPSLVTYNILVSGFCR 385

Query: 75 EGFGEDAEK-VDEMQ 34
+G A K V EM+
Sbjct: 386 KGDTSGAAKMVKEME 400



Score = 42.4 bits (98), Expect = 9e-04
Identities = 18/70 (25%), Positives = 40/70 (57%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C PN ++Y+T+I G + G++ A L+ EM+ + P+ +Y+ ++ ++ +A
Sbjct: 474 CEPNEVIYNTMILGYCKEGSSYRALKLLKEMEEKELAPNVASYRYMIEVLCKERKSKEAE 533

Query: 261 QLFEQVLQDG 232
+L E+++ G
Sbjct: 534 RLVEKMIDSG 543



Score = 36.2 bits (82), Expect = 0.063
Identities = 30/124 (24%), Positives = 52/124 (41%)
Frame = -3

Query: 423 VYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQV 244
+Y +I ++ + L+ S EM GF P + LL S Q F +
Sbjct: 96 LYEVIINSYVQSQSLNLSISYFNEMVDNGFVPGSNCFNYLLTFVVGSSSFNQWWSFFNEN 155

Query: 243 LQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKEGFG 64
+ L +F +++K +++F L + E GF P+ Y ++ DG K+G
Sbjct: 156 -KSKVVLDVYSFGILIKGCCEAGEIEKSFDLLIELTEFGFSPNVVIYTTLIDGCCKKGEI 214

Query: 63 EDAE 52
E A+
Sbjct: 215 EKAK 218


>sp|Q9FNL2|PP418_ARATH Pentatricopeptide repeat-containing protein
At5g46100 OS=Arabidopsis thaliana GN=At5g46100 PE=2 SV=1
Length = 472

Score = 74.3 bits (181), Expect = 2e-13
Identities = 46/138 (33%), Positives = 67/138 (48%), Gaps = 1/138 (0%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C+P + Y++LI G + N A + EM ++G EP+ TY L+ G GR+ QA
Sbjct: 223 CAPTVVTYTSLINGLCGSKNVDEAMRYLEEMKSKGIEPNVFTYSSLMDGLCKDGRSLQAM 282

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+LFE ++ G + T+ ++ L + QEA + L RM G PD Y V G
Sbjct: 283 ELFEMMMARGCRPNMVTYTTLITGLCKEQKIQEAVELLDRMNLQGLKPDAGLYGKVISGF 342

Query: 81 -RKEGFGEDAEKVDEMQL 31
F E A +DEM L
Sbjct: 343 CAISKFREAANFLDEMIL 360



Score = 72.0 bits (175), Expect = 1e-12
Identities = 39/123 (31%), Positives = 62/123 (50%)
Frame = -3

Query: 399 CGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQVLQDGQHLH 220
C G + LEM RG +PD TY L++G GR +A +LF ++++
Sbjct: 167 CRNDGTVDAGLKIFLEMPKRGCDPDSYTYGTLISGLCRFGRIDEAKKLFTEMVEKDCAPT 226

Query: 219 AETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKEGFGEDAEKVDE 40
T+ ++ L G EA +YL+ M G +P+ +TY S+ DGL K+G A ++ E
Sbjct: 227 VVTYTSLINGLCGSKNVDEAMRYLEEMKSKGIEPNVFTYSSLMDGLCKDGRSLQAMELFE 286

Query: 39 MQL 31
M +
Sbjct: 287 MMM 289



Score = 50.8 bits (120), Expect = 2e-06
Identities = 29/111 (26%), Positives = 53/111 (47%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN YS+L+ G + G + A L M ARG P+ +TY L+ G + +A +L
Sbjct: 260 PNVFTYSSLMDGLCKDGRSLQAMELFEMMMARGCRPNMVTYTTLITGLCKEQKIQEAVEL 319

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTY 103
+++ G A + ++ +++ +EA +L M+ G P+ T+
Sbjct: 320 LDRMNLQGLKPDAGLYGKVISGFCAISKFREAANFLDEMILGGITPNRLTW 370



Score = 48.9 bits (115), Expect = 9e-06
Identities = 36/143 (25%), Positives = 66/143 (46%), Gaps = 8/143 (5%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C PN + Y+TLI G + Q A L+ M+ +G +PD Y +++G+ + +A
Sbjct: 293 CRPNMVTYTTLITGLCKEQKIQEAVELLDRMNLQGLKPDAGLYGKVISGFCAISKFREAA 352

Query: 261 QLFEQVLQDG-------QHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTY 103
++++ G ++H +T +++ L N AF M G + T
Sbjct: 353 NFLDEMILGGITPNRLTWNIHVKTSNEVVRGLC-ANYPSRAFTLYLSMRSRGISVEVETL 411

Query: 102 KSVNDGLRKEG-FGEDAEKVDEM 37
+S+ L K+G F + + VDE+
Sbjct: 412 ESLVKCLCKKGEFQKAVQLVDEI 434


>sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protein
At1g05665, mitochondrial OS=Arabidopsis thaliana
GN=At1g05665 PE=2 SV=1
Length = 741

Score = 73.9 bits (180), Expect = 3e-13
Identities = 39/130 (30%), Positives = 68/130 (52%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ +VY+TLI G + G+ + A EM +R PD LTY +++G+ G +A +L
Sbjct: 349 PDTVVYTTLIDGFCKRGDIRAASKFFYEMHSRDITPDVLTYTAIISGFCQIGDMVEAGKL 408

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F ++ G + TF ++ ++AF+ M++ G P+ TY ++ DGL K
Sbjct: 409 FHEMFCKGLEPDSVTFTELINGYCKAGHMKDAFRVHNHMIQAGCSPNVVTYTTLIDGLCK 468

Query: 75 EGFGEDAEKV 46
EG + A ++
Sbjct: 469 EGDLDSANEL 478



Score = 67.4 bits (163), Expect = 3e-11
Identities = 38/131 (29%), Positives = 67/131 (51%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
+P+ + Y+ +I G + G+ A L EM +G EPD +T+ L+ GY +G A +
Sbjct: 383 TPDVLTYTAIISGFCQIGDMVEAGKLFHEMFCKGLEPDSVTFTELINGYCKAGHMKDAFR 442

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
+ ++Q G + T+ ++ L A + L M ++G P+ +TY S+ +GL
Sbjct: 443 VHNHMIQAGCSPNVVTYTTLIDGLCKEGDLDSANELLHEMWKIGLQPNIFTYNSIVNGLC 502

Query: 78 KEGFGEDAEKV 46
K G E+A K+
Sbjct: 503 KSGNIEEAVKL 513



Score = 64.7 bits (156), Expect = 2e-10
Identities = 38/132 (28%), Positives = 61/132 (46%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
CSPN + Y+TLI G + G+ A L+ EM G +P+ TY ++ G SG +A
Sbjct: 452 CSPNVVTYTTLIDGLCKEGDLDSANELLHEMWKIGLQPNIFTYNSIVNGLCKSGNIEEAV 511

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+L + G + T+ ++ +A + L+ ML G P T+ + +G
Sbjct: 512 KLVGEFEAAGLNADTVTYTTLMDAYCKSGEMDKAQEILKEMLGKGLQPTIVTFNVLMNGF 571

Query: 81 RKEGFGEDAEKV 46
G ED EK+
Sbjct: 572 CLHGMLEDGEKL 583



Score = 56.2 bits (134), Expect = 6e-08
Identities = 31/114 (27%), Positives = 56/114 (49%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN Y++++ G ++GN + A L+ E +A G D +TY L+ Y SG +A ++
Sbjct: 489 PNIFTYNSIVNGLCKSGNIEEAVKLVGEFEAAGLNADTVTYTTLMDAYCKSGEMDKAQEI 548

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSV 94
+++L G TF V++ ++ + L ML G P+ T+ S+
Sbjct: 549 LKEMLGKGLQPTIVTFNVLMNGFCLHGMLEDGEKLLNWMLAKGIAPNATTFNSL 602



Score = 52.8 bits (125), Expect = 6e-07
Identities = 31/121 (25%), Positives = 59/121 (48%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
N Y+ +I+ + G + A L+L M+ +G+ PD ++Y ++ GY G + +L
Sbjct: 245 NVASYNIVIHFVCQLGRIKEAHHLLLLMELKGYTPDVISYSTVVNGYCRFGELDKVWKLI 304

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKE 73
E + + G ++ + ++ L + + EA + M+ G PDT Y ++ DG K
Sbjct: 305 EVMKRKGLKPNSYIYGSIIGLLCRICKLAEAEEAFSEMIRQGILPDTVVYTTLIDGFCKR 364

Query: 72 G 70
G
Sbjct: 365 G 365



Score = 49.7 bits (117), Expect = 5e-06
Identities = 29/116 (25%), Positives = 55/116 (47%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
+ + Y+TL+ ++G A+ ++ EM +G +P +T+ L+ G+ + G +L
Sbjct: 525 DTVTYTTLMDAYCKSGEMDKAQEILKEMLGKGLQPTIVTFNVLMNGFCLHGMLEDGEKLL 584

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG 85
+L G +A TF ++K N + A + M G PD TY+++ G
Sbjct: 585 NWMLAKGIAPNATTFNSLVKQYCIRNNLKAATAIYKDMCSRGVGPDGKTYENLVKG 640



Score = 47.4 bits (111), Expect = 3e-05
Identities = 31/130 (23%), Positives = 61/130 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+++ ++ LI G +AG+ + A + M G P+ +TY L+ G G A +L
Sbjct: 419 PDSVTFTELINGYCKAGHMKDAFRVHNHMIQAGCSPNVVTYTTLIDGLCKEGDLDSANEL 478

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
++ + G + T+ ++ L +EA + + G + DT TY ++ D K
Sbjct: 479 LHEMWKIGLQPNIFTYNSIVNGLCKSGNIEEAVKLVGEFEAAGLNADTVTYTTLMDAYCK 538

Query: 75 EGFGEDAEKV 46
G + A+++
Sbjct: 539 SGEMDKAQEI 548



Score = 45.1 bits (105), Expect = 1e-04
Identities = 28/117 (23%), Positives = 55/117 (47%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
+PNA +++L+ N + A ++ +M +RG PD TY+ L+ G+ + +A
Sbjct: 593 APNATTFNSLVKQYCIRNNLKAATAIYKDMCSRGVGPDGKTYENLVKGHCKARNMKEAWF 652

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVND 88
LF+++ G + T+ V++K + EA + +M G D + +D
Sbjct: 653 LFQEMKGKGFSVSVSTYSVLIKGFLKRKKFLEAREVFDQMRREGLAADKEIFDFFSD 709



Score = 44.7 bits (104), Expect = 2e-04
Identities = 35/144 (24%), Positives = 64/144 (44%), Gaps = 4/144 (2%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P + ++ L+ G G + + L+ M A+G P+ T+ L+ Y + A +
Sbjct: 559 PTIVTFNVLMNGFCLHGMLEDGEKLLNWMLAKGIAPNATTFNSLVKQYCIRNNLKAATAI 618

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG-LR 79
++ + G +T++ ++K +EA+ Q M GF TY + G L+
Sbjct: 619 YKDMCSRGVGPDGKTYENLVKGHCKARNMKEAWFLFQEMKGKGFSVSVSTYSVLIKGFLK 678

Query: 78 KEGFGEDAEKVDEMQ---LLARKE 16
++ F E E D+M+ L A KE
Sbjct: 679 RKKFLEAREVFDQMRREGLAADKE 702


>sp|Q9LPX2|PPR39_ARATH Pentatricopeptide repeat-containing protein
At1g12775, mitochondrial OS=Arabidopsis thaliana
GN=At1g12775 PE=2 SV=1
Length = 644

Score = 73.2 bits (178), Expect = 5e-13
Identities = 43/140 (30%), Positives = 74/140 (52%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
+A+ YS +I G + G+ A +L EM+ +GF+ D +TY L+ G+ +GR +L
Sbjct: 262 DAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLIGGFCNAGRWDDGAKLL 321

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKE 73
+++ + TF V++ + +EA Q L+ M++ G P+T TY S+ DG KE
Sbjct: 322 RDMIKRKISPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLIDGFCKE 381

Query: 72 GFGEDAEKVDEMQLLARKEC 13
E+A + + L+ K C
Sbjct: 382 NRLEEA--IQMVDLMISKGC 399



Score = 63.5 bits (153), Expect = 4e-10
Identities = 38/143 (26%), Positives = 70/143 (48%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SPN + +S LI + G + A L+ EM RG P+ +TY L+ G+ R +A Q
Sbjct: 330 SPNVVTFSVLIDSFVKEGKLREADQLLKEMMQRGIAPNTITYNSLIDGFCKENRLEEAIQ 389

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
+ + ++ G TF +++ NR + + + M G +T TY ++ G
Sbjct: 390 MVDLMISKGCDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLVQGFC 449

Query: 78 KEGFGEDAEKVDEMQLLARKECP 10
+ G E A+K+ + ++++R+ P
Sbjct: 450 QSGKLEVAKKLFQ-EMVSRRVRP 471



Score = 56.2 bits (134), Expect = 6e-08
Identities = 34/131 (25%), Positives = 64/131 (48%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
+PN I Y++LI G + + A ++ M ++G +PD +T+ L+ GY + R +
Sbjct: 365 APNTITYNSLIDGFCKENRLEEAIQMVDLMISKGCDPDIMTFNILINGYCKANRIDDGLE 424

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
LF ++ G + T+ +++ + + A + Q M+ PD +YK + DGL
Sbjct: 425 LFREMSLRGVIANTVTYNTLVQGFCQSGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLC 484

Query: 78 KEGFGEDAEKV 46
G E A ++
Sbjct: 485 DNGELEKALEI 495



Score = 52.8 bits (125), Expect = 6e-07
Identities = 29/125 (23%), Positives = 61/125 (48%), Gaps = 1/125 (0%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
N + Y+TL+ G ++G ++AK L EM +R PD ++YK LL G +G +A ++F
Sbjct: 437 NTVTYNTLVQGFCQSGKLEVAKKLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEIF 496

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYK-SVNDGLRK 76
++ + L + +++ + ++ +A+ + G D Y +++ RK
Sbjct: 497 GKIEKSKMELDIGIYMIIIHGMCNASKVDDAWDLFCSLPLKGVKLDARAYNIMISELCRK 556

Query: 75 EGFGE 61
+ +
Sbjct: 557 DSLSK 561



Score = 50.1 bits (118), Expect = 4e-06
Identities = 36/130 (27%), Positives = 56/130 (43%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P I +TL+ G G A L+ M GF+P+ +TY +L SG+TA A +L
Sbjct: 191 PTLITLNTLVNGLCLNGKVSDAVVLIDRMVETGFQPNEVTYGPVLNVMCKSGQTALAMEL 250

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
++ + L A + +++ L AF M GF D TY ++ G
Sbjct: 251 LRKMEERNIKLDAVKYSIIIDGLCKDGSLDNAFNLFNEMEIKGFKADIITYNTLIGGFCN 310

Query: 75 EGFGEDAEKV 46
G +D K+
Sbjct: 311 AGRWDDGAKL 320



Score = 48.9 bits (115), Expect = 9e-06
Identities = 32/136 (23%), Positives = 67/136 (49%), Gaps = 1/136 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ ++++TL+ G A L+ M G +P +T L+ G ++G+ + A L
Sbjct: 156 PDTVIFNTLLNGLCLECRVSEALELVDRMVEMGHKPTLITLNTLVNGLCLNGKVSDAVVL 215

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
+++++ G + T+ +L + + A + L++M E D Y + DGL K
Sbjct: 216 IDRMVETGFQPNEVTYGPVLNVMCKSGQTALAMELLRKMEERNIKLDAVKYSIIIDGLCK 275

Query: 75 EGFGEDAEKV-DEMQL 31
+G ++A + +EM++
Sbjct: 276 DGSLDNAFNLFNEMEI 291



Score = 46.6 bits (109), Expect = 5e-05
Identities = 29/129 (22%), Positives = 58/129 (44%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ + ++ LI G +A L EM RG + +TY L+ G+ SG+ A
Sbjct: 399 CDPDIMTFNILINGYCKANRIDDGLELFREMSLRGVIANTVTYNTLVQGFCQSGKLEVAK 458

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+LF++++ ++K++L L ++A + ++ + + D Y + G+
Sbjct: 459 KLFQEMVSRRVRPDIVSYKILLDGLCDNGELEKALEIFGKIEKSKMELDIGIYMIIIHGM 518

Query: 81 RKEGFGEDA 55
+DA
Sbjct: 519 CNASKVDDA 527



Score = 33.1 bits (74), Expect = 0.53
Identities = 21/83 (25%), Positives = 35/83 (42%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
+A Y+ +I R + A L +M G PD LTY L+ + A +L
Sbjct: 542 DARAYNIMISELCRKDSLSKADILFRKMTEEGHAPDELTYNILIRAHLGDDDATTAAELI 601

Query: 252 EQVLQDGQHLHAETFKVMLKHLA 184
E++ G T K+++ L+
Sbjct: 602 EEMKSSGFPADVSTVKMVINMLS 624



Score = 32.7 bits (73), Expect = 0.69
Identities = 24/105 (22%), Positives = 46/105 (43%), Gaps = 1/105 (0%)
Frame = -3

Query: 330 PDWLTYKCLLAGYAVSGRTAQACQLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQY 151
P + + L + A + + L +Q+ G T +M+ + AF
Sbjct: 86 PTVIDFNRLFSAIAKTKQYELVLALCKQMESKGIAHSIYTLSIMINCFCRCRKLSYAFST 145

Query: 150 LQRMLELGFDPDTWTYKSVNDGLRKE-GFGEDAEKVDEMQLLARK 19
+ ++++LG++PDT + ++ +GL E E E VD M + K
Sbjct: 146 MGKIMKLGYEPDTVIFNTLLNGLCLECRVSEALELVDRMVEMGHK 190


>sp|Q9M1D8|PP288_ARATH Pentatricopeptide repeat-containing protein
At3g60050 OS=Arabidopsis thaliana GN=At3g60050 PE=2 SV=1
Length = 473

Score = 73.2 bits (178), Expect = 5e-13
Identities = 43/130 (33%), Positives = 67/130 (51%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + Y+TLI G RAGN + K + EM G PD + Y ++ GY VSG +A ++
Sbjct: 322 PSVLHYTTLIDGLSRAGNLEACKYFLDEMVKAGCRPDVVCYTVMITGYVVSGELDKAKEM 381

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F ++ GQ + T+ M++ L +EA L+ M G +P+ Y ++ LRK
Sbjct: 382 FREMTVKGQLPNVFTYNSMIRGLCMAGEFREACWLLKEMESRGCNPNFVVYSTLVSYLRK 441

Query: 75 EGFGEDAEKV 46
G +A KV
Sbjct: 442 AGKLSEARKV 451



Score = 52.8 bits (125), Expect = 6e-07
Identities = 25/105 (23%), Positives = 53/105 (50%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ + Y+ +I G +G AK + EM +G P+ TY ++ G ++G +AC
Sbjct: 355 CRPDVVCYTVMITGYVVSGELDKAKEMFREMTVKGQLPNVFTYNSMIRGLCMAGEFREAC 414

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELG 127
L +++ G + + + ++ +L + EA + ++ M++ G
Sbjct: 415 WLLKEMESRGCNPNFVVYSTLVSYLRKAGKLSEARKVIREMVKKG 459



Score = 52.0 bits (123), Expect = 1e-06
Identities = 30/90 (33%), Positives = 46/90 (51%)
Frame = -3

Query: 339 GFEPDWLTYKCLLAGYAVSGRTAQACQLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEA 160
GF PD LTY LL G+ + +LF+++ +DG + T+ ++L L N+ A
Sbjct: 249 GFSPDVLTYNILLWTNYRLGKMDRFDRLFDEMARDGFSPDSYTYNILLHILGKGNKPLAA 308

Query: 159 FQYLQRMLELGFDPDTWTYKSVNDGLRKEG 70
L M E+G DP Y ++ DGL + G
Sbjct: 309 LTTLNHMKEVGIDPSVLHYTTLIDGLSRAG 338



Score = 45.8 bits (107), Expect = 8e-05
Identities = 20/72 (27%), Positives = 44/72 (61%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN Y+++I G AG + A L+ EM++RG P+++ Y L++ +G+ ++A ++
Sbjct: 392 PNVFTYNSMIRGLCMAGEFREACWLLKEMESRGCNPNFVVYSTLVSYLRKAGKLSEARKV 451

Query: 255 FEQVLQDGQHLH 220
++++ G ++H
Sbjct: 452 IREMVKKGHYVH 463



Score = 38.1 bits (87), Expect = 0.016
Identities = 31/134 (23%), Positives = 50/134 (37%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ + Y+ L++ R G L EM GF PD TY LL + A
Sbjct: 251 SPDVLTYNILLWTNYRLGKMDRFDRLFDEMARDGFSPDSYTYNILLHILGKGNKPLAALT 310

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
+ + G + ++ L+ + +L M++ G PD Y + G
Sbjct: 311 TLNHMKEVGIDPSVLHYTTLIDGLSRAGNLEACKYFLDEMVKAGCRPDVVCYTVMITGYV 370

Query: 78 KEGFGEDAEKVDEM 37
G + +K EM
Sbjct: 371 VSG---ELDKAKEM 381



Score = 37.0 bits (84), Expect = 0.037
Identities = 25/109 (22%), Positives = 47/109 (43%)
Frame = -3

Query: 429 AIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFE 250
A ++ LI CG AG A+ A ++ + P +Y +L + +++
Sbjct: 184 ARTFNLLICSCGEAGLAKQAVVQFMKSKTFNYRPFKHSYNAILNSLLGVKQYKLIEWVYK 243

Query: 249 QVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTY 103
Q+L+DG T+ ++L + + + M GF PD++TY
Sbjct: 244 QMLEDGFSPDVLTYNILLWTNYRLGKMDRFDRLFDEMARDGFSPDSYTY 292



Score = 33.5 bits (75), Expect = 0.41
Identities = 27/106 (25%), Positives = 41/106 (38%)
Frame = -3

Query: 420 YSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQVL 241
Y L+ G + L+ EM GF T+ L+ +G QA F +
Sbjct: 152 YHLLMKIFAECGEYKAMWRLVDEMVQDGFPTTARTFNLLICSCGEAGLAKQAVVQFMKSK 211

Query: 240 QDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTY 103
++ +L L GV + + ++MLE GF PD TY
Sbjct: 212 TFNYRPFKHSYNAILNSLLGVKQYKLIEWVYKQMLEDGFSPDVLTY 257


>sp|Q9FIX3|PP407_ARATH Pentatricopeptide repeat-containing protein
At5g39710 OS=Arabidopsis thaliana GN=EMB2745 PE=2 SV=1
Length = 747

Score = 71.6 bits (174), Expect = 1e-12
Identities = 39/131 (29%), Positives = 69/131 (52%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ + YST++ G R+ + A + EM +G +PD +TY L+ G+ RT +AC
Sbjct: 447 SPDVVSYSTVLSGFCRSYDVDEALRVKREMVEKGIKPDTITYSSLIQGFCEQRRTKEACD 506

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
L+E++L+ G T+ ++ ++A Q M+E G PD TY + +GL
Sbjct: 507 LYEEMLRVGLPPDEFTYTALINAYCMEGDLEKALQLHNEMVEKGVLPDVVTYSVLINGLN 566

Query: 78 KEGFGEDAEKV 46
K+ +A+++
Sbjct: 567 KQSRTREAKRL 577



Score = 66.6 bits (161), Expect = 4e-11
Identities = 36/130 (27%), Positives = 64/130 (49%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN I Y+ +I G R G + ++ EM+ RG+ D +TY L+ GY G QA +
Sbjct: 273 PNLISYNVVINGLCREGRMKEVSFVLTEMNRRGYSLDEVTYNTLIKGYCKEGNFHQALVM 332

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
++L+ G T+ ++ + A ++L +M G P+ TY ++ DG +
Sbjct: 333 HAEMLRHGLTPSVITYTSLIHSMCKAGNMNRAMEFLDQMRVRGLCPNERTYTTLVDGFSQ 392

Query: 75 EGFGEDAEKV 46
+G+ +A +V
Sbjct: 393 KGYMNEAYRV 402



Score = 63.9 bits (154), Expect = 3e-10
Identities = 35/117 (29%), Positives = 56/117 (47%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN Y+TL+ G + G A ++ EM+ GF P +TY L+ G+ V+G+ A +
Sbjct: 378 PNERTYTTLVDGFSQKGYMNEAYRVLREMNDNGFSPSVVTYNALINGHCVTGKMEDAIAV 437

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG 85
E + + G ++ +L EA + + M+E G PDT TY S+ G
Sbjct: 438 LEDMKEKGLSPDVVSYSTVLSGFCRSYDVDEALRVKREMVEKGIKPDTITYSSLIQG 494



Score = 58.2 bits (139), Expect = 2e-08
Identities = 33/128 (25%), Positives = 65/128 (50%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ + Y+ LI G G + A +++ +M +G PD ++Y +L+G+ S +A +
Sbjct: 412 SPSVVTYNALINGHCVTGKMEDAIAVLEDMKEKGLSPDVVSYSTVLSGFCRSYDVDEALR 471

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
+ ++++ G T+ +++ R +EA + ML +G PD +TY ++ +
Sbjct: 472 VKREMVEKGIKPDTITYSSLIQGFCEQRRTKEACDLYEEMLRVGLPPDEFTYTALINAYC 531

Query: 78 KEGFGEDA 55
EG E A
Sbjct: 532 MEGDLEKA 539



Score = 56.6 bits (135), Expect = 4e-08
Identities = 36/123 (29%), Positives = 57/123 (46%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SPN Y+ LI G AGN +A +L +M+ +G P+ +TY L+ GY + +
Sbjct: 202 SPNVFTYNILIRGFCFAGNIDVALTLFDKMETKGCLPNVVTYNTLIDGYCKLRKIDDGFK 261

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
L + G + ++ V++ L R +E L M G+ D TY ++ G
Sbjct: 262 LLRSMALKGLEPNLISYNVVINGLCREGRMKEVSFVLTEMNRRGYSLDEVTYNTLIKGYC 321

Query: 78 KEG 70
KEG
Sbjct: 322 KEG 324



Score = 54.3 bits (129), Expect = 2e-07
Identities = 37/133 (27%), Positives = 61/133 (45%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
S + + Y+TLI G + GN A + EM G P +TY L+ +G +A +
Sbjct: 307 SLDEVTYNTLIKGYCKEGNFHQALVMHAEMLRHGLTPSVITYTSLIHSMCKAGNMNRAME 366

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
+Q+ G + T+ ++ + EA++ L+ M + GF P TY ++ +G
Sbjct: 367 FLDQMRVRGLCPNERTYTTLVDGFSQKGYMNEAYRVLREMNDNGFSPSVVTYNALINGHC 426

Query: 78 KEGFGEDAEKVDE 40
G EDA V E
Sbjct: 427 VTGKMEDAIAVLE 439



Score = 49.7 bits (117), Expect = 5e-06
Identities = 33/114 (28%), Positives = 53/114 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ I YS+LI G + A L EM G PD TY L+ Y + G +A QL
Sbjct: 483 PDTITYSSLIQGFCEQRRTKEACDLYEEMLRVGLPPDEFTYTALINAYCMEGDLEKALQL 542

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSV 94
++++ G T+ V++ L +R +EA + L ++ P TY ++
Sbjct: 543 HNEMVEKGVLPDVVTYSVLINGLNKQSRTREAKRLLLKLFYEESVPSDVTYHTL 596



Score = 47.0 bits (110), Expect = 4e-05
Identities = 29/123 (23%), Positives = 58/123 (47%), Gaps = 1/123 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAG-NAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
P + Y+ ++ R+ N A+++ EM P+ TY L+ G+ +G A
Sbjct: 167 PGVLSYNAVLDATIRSKRNISFAENVFKEMLESQVSPNVFTYNILIRGFCFAGNIDVALT 226

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
LF+++ G + T+ ++ + + + F+ L+ M G +P+ +Y V +GL
Sbjct: 227 LFDKMETKGCLPNVVTYNTLIDGYCKLRKIDDGFKLLRSMALKGLEPNLISYNVVINGLC 286

Query: 78 KEG 70
+EG
Sbjct: 287 REG 289



Score = 35.8 bits (81), Expect = 0.082
Identities = 28/120 (23%), Positives = 49/120 (40%), Gaps = 18/120 (15%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLA--------KSLMLEMD-------ARGFEPDWLTYKCLL 301
P+ + Y TLI C + K +M E D + +PD Y ++
Sbjct: 588 PSDVTYHTLIENCSNIEFKSVVSLIKGFCMKGMMTEADQVFESMLGKNHKPDGTAYNIMI 647

Query: 300 AGYAVSGRTAQACQLFEQVLQDGQHLHAETFKVMLKHL---AGVNRAQEAFQYLQRMLEL 130
G+ +G +A L++++++ G LH T ++K L VN ++ R EL
Sbjct: 648 HGHCRAGDIRKAYTLYKEMVKSGFLLHTVTVIALVKALHKEGKVNELNSVIVHVLRSCEL 707



Score = 35.0 bits (79), Expect = 0.14
Identities = 27/123 (21%), Positives = 50/123 (40%), Gaps = 1/123 (0%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQ-A 265
C + V+ ++ R A S++ A GF P L+Y +L S R A
Sbjct: 130 CYSTSSVFDLVVKSYSRLSLIDKALSIVHLAQAHGFMPGVLSYNAVLDATIRSKRNISFA 189

Query: 264 CQLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG 85
+F+++L+ + T+ ++++ A +M G P+ TY ++ DG
Sbjct: 190 ENVFKEMLESQVSPNVFTYNILIRGFCFAGNIDVALTLFDKMETKGCLPNVVTYNTLIDG 249

Query: 84 LRK 76
K
Sbjct: 250 YCK 252



Score = 34.7 bits (78), Expect = 0.18
Identities = 27/107 (25%), Positives = 46/107 (42%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ Y+ +I+G RAG+ + A +L EM GF +T L+ G+ + +
Sbjct: 638 PDGTAYNIMIHGHCRAGDIRKAYTLYKEMVKSGFLLHTVTVIALVKALHKEGKVNELNSV 697

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPD 115
VL+ + AE KV+++ L M + GF P+
Sbjct: 698 IVHVLRSCELSEAEQAKVLVEINHREGNMDVVLDVLAEMAKDGFLPN 744


>sp|Q9SUD8|PP340_ARATH Pentatricopeptide repeat-containing protein
At4g28010 OS=Arabidopsis thaliana GN=At4g28010 PE=2 SV=1
Length = 704

Score = 71.2 bits (173), Expect = 2e-12
Identities = 40/130 (30%), Positives = 70/130 (53%)
Frame = -3

Query: 426 IVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQ 247
+VY++LI G G K+L E+ RG P +TY L+ G+ G+ +A ++FE
Sbjct: 248 VVYTSLIRGFCDCGELDRGKALFDEVLERGDSPCAITYNTLIRGFCKLGQLKEASEIFEF 307

Query: 246 VLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKEGF 67
+++ G + T+ ++ L GV + +EA Q L M+E +P+ TY + + L K+G
Sbjct: 308 MIERGVRPNVYTYTGLIDGLCGVGKTKEALQLLNLMIEKDEEPNAVTYNIIINKLCKDGL 367

Query: 66 GEDAEKVDEM 37
DA ++ E+
Sbjct: 368 VADAVEIVEL 377



Score = 65.9 bits (159), Expect = 7e-11
Identities = 39/142 (27%), Positives = 69/142 (48%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
CS + + + LI +AG A + EM G E D + Y L+ G+ G +
Sbjct: 208 CSWSLVTWGILIDAFCKAGKMDEAMGFLKEMKFMGLEADLVVYTSLIRGFCDCGELDRGK 267

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
LF++VL+ G A T+ +++ + + +EA + + M+E G P+ +TY + DGL
Sbjct: 268 ALFDEVLERGDSPCAITYNTLIRGFCKLGQLKEASEIFEFMIERGVRPNVYTYTGLIDGL 327

Query: 81 RKEGFGEDAEKVDEMQLLARKE 16
G G+ E + + L+ K+
Sbjct: 328 C--GVGKTKEALQLLNLMIEKD 347



Score = 60.5 bits (145), Expect = 3e-09
Identities = 38/131 (29%), Positives = 65/131 (49%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP AI Y+TLI G + G + A + M RG P+ TY L+ G G+T +A Q
Sbjct: 279 SPCAITYNTLIRGFCKLGQLKEASEIFEFMIERGVRPNVYTYTGLIDGLCGVGKTKEALQ 338

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
L +++ + +A T+ +++ L +A + ++ M + PD TY + GL
Sbjct: 339 LLNLMIEKDEEPNAVTYNIIINKLCKDGLVADAVEIVELMKKRRTRPDNITYNILLGGLC 398

Query: 78 KEGFGEDAEKV 46
+G ++A K+
Sbjct: 399 AKGDLDEASKL 409



Score = 58.5 bits (140), Expect = 1e-08
Identities = 34/126 (26%), Positives = 57/126 (45%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
N+ Y+ +I G + G +AK L+ +M +P Y CLL+ G QA +LF
Sbjct: 493 NSDTYTAMIDGFCKTGMLNVAKGLLCKMRVSELQPSVFDYNCLLSSLCKEGSLDQAWRLF 552

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKE 73
E++ +D +F +M+ + A L M G PD +TY + + K
Sbjct: 553 EEMQRDNNFPDVVSFNIMIDGSLKAGDIKSAESLLVGMSRAGLSPDLFTYSKLINRFLKL 612

Query: 72 GFGEDA 55
G+ ++A
Sbjct: 613 GYLDEA 618



Score = 43.1 bits (100), Expect = 5e-04
Identities = 22/101 (21%), Positives = 50/101 (49%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + ++ +I G +AG+ + A+SL++ M G PD TY L+ + G +A
Sbjct: 562 PDVVSFNIMIDGSLKAGDIKSAESLLVGMSRAGLSPDLFTYSKLINRFLKLGYLDEAISF 621

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLE 133
F++++ G A +LK+ + + ++++++
Sbjct: 622 FDKMVDSGFEPDAHICDSVLKYCISQGETDKLTELVKKLVD 662



Score = 40.4 bits (93), Expect = 0.003
Identities = 26/103 (25%), Positives = 46/103 (44%), Gaps = 2/103 (1%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PNA+ Y+ +I + G A ++ M R PD +TY LL G G +A +L
Sbjct: 350 PNAVTYNIIINKLCKDGLVADAVEIVELMKKRRTRPDNITYNILLGGLCAKGDLDEASKL 409

Query: 255 FEQVLQDGQHLHAE--TFKVMLKHLAGVNRAQEAFQYLQRMLE 133
+L+D + + ++ ++ L NR +A ++E
Sbjct: 410 LYLMLKDSSYTDPDVISYNALIHGLCKENRLHQALDIYDLLVE 452


>sp|Q3EDF8|PPR28_ARATH Pentatricopeptide repeat-containing protein
At1g09900 OS=Arabidopsis thaliana GN=At1g09900 PE=2 SV=1
Length = 598

Score = 70.9 bits (172), Expect = 2e-12
Identities = 40/129 (31%), Positives = 66/129 (51%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
CSP I Y+T+I G +AG A L+ EM A+ +PD +TY L+ G + G+ +A
Sbjct: 445 CSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGLSREGKVDEAI 504

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+ F + + G +A TF ++ L + A +L M+ G P+ +Y + +GL
Sbjct: 505 KFFHEFERMGIRPNAVTFNSIMLGLCKSRQTDRAIDFLVFMINRGCKPNETSYTILIEGL 564

Query: 81 RKEGFGEDA 55
EG ++A
Sbjct: 565 AYEGMAKEA 573



Score = 63.9 bits (154), Expect = 3e-10
Identities = 39/143 (27%), Positives = 69/143 (48%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C PN I ++ ++ G A+ L+ +M +GF P +T+ L+ G +A
Sbjct: 305 CQPNVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFLCRKGLLGRAI 364

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+ E++ Q G ++ ++ +L + A +YL+RM+ G PD TY ++ L
Sbjct: 365 DILEKMPQHGCQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTAL 424

Query: 81 RKEGFGEDAEKVDEMQLLARKEC 13
K+G EDA V+ + L+ K C
Sbjct: 425 CKDGKVEDA--VEILNQLSSKGC 445



Score = 63.5 bits (153), Expect = 4e-10
Identities = 37/131 (28%), Positives = 61/131 (46%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C PN++ Y+ L++G + A + M +RG PD +TY +L G+ A
Sbjct: 375 CQPNSLSYNPLLHGFCKEKKMDRAIEYLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAV 434

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
++ Q+ G T+ ++ LA + +A + L M PDT TY S+ GL
Sbjct: 435 EILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAIKLLDEMRAKDLKPDTITYSSLVGGL 494

Query: 81 RKEGFGEDAEK 49
+EG ++A K
Sbjct: 495 SREGKVDEAIK 505



Score = 58.5 bits (140), Expect = 1e-08
Identities = 38/136 (27%), Positives = 68/136 (50%), Gaps = 1/136 (0%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ + ++ LI R G A ++ +M G +P+ L+Y LL G+ + +A +
Sbjct: 341 SPSVVTFNILINFLCRKGLLGRAIDILEKMPQHGCQPNSLSYNPLLHGFCKEKKMDRAIE 400

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
E+++ G + T+ ML L + ++A + L ++ G P TY +V DGL
Sbjct: 401 YLERMVSRGCYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLA 460

Query: 78 KEG-FGEDAEKVDEMQ 34
K G G+ + +DEM+
Sbjct: 461 KAGKTGKAIKLLDEMR 476



Score = 58.2 bits (139), Expect = 2e-08
Identities = 36/124 (29%), Positives = 56/124 (45%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ I Y+ LI R A L+ EM RG PD +TY L+ G GR +A
Sbjct: 235 CYPDVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDVVTYNVLVNGICKEGRLDEAI 294

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+ + G + T ++L+ + R +A + L ML GF P T+ + + L
Sbjct: 295 KFLNDMPSSGCQPNVITHNIILRSMCSTGRWMDAEKLLADMLRKGFSPSVVTFNILINFL 354

Query: 81 RKEG 70
++G
Sbjct: 355 CRKG 358



Score = 57.8 bits (138), Expect = 2e-08
Identities = 36/129 (27%), Positives = 64/129 (49%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ I Y+ +I G +AG A S++ D PD +TY +L SG+ QA ++
Sbjct: 170 PDVITYNVMISGYCKAGEINNALSVL---DRMSVSPDVVTYNTILRSLCDSGKLKQAMEV 226

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
+++LQ + T+ ++++ + A + L M + G PD TY + +G+ K
Sbjct: 227 LDRMLQRDCYPDVITYTILIEATCRDSGVGHAMKLLDEMRDRGCTPDVVTYNVLVNGICK 286

Query: 75 EGFGEDAEK 49
EG ++A K
Sbjct: 287 EGRLDEAIK 295



Score = 56.6 bits (135), Expect = 4e-08
Identities = 36/135 (26%), Positives = 65/135 (48%), Gaps = 1/135 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ I +TLI G R G + A ++ ++ G PD +TY +++GY +G A +
Sbjct: 135 PDIIPCTTLIRGFCRLGKTRKAAKILEILEGSGAVPDVITYNVMISGYCKAGEINNALSV 194

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG-LR 79
+++ T+ +L+ L + ++A + L RML+ PD TY + + R
Sbjct: 195 LDRMSVSPD---VVTYNTILRSLCDSGKLKQAMEVLDRMLQRDCYPDVITYTILIEATCR 251

Query: 78 KEGFGEDAEKVDEMQ 34
G G + +DEM+
Sbjct: 252 DSGVGHAMKLLDEMR 266



Score = 55.5 bits (132), Expect = 1e-07
Identities = 27/122 (22%), Positives = 61/122 (50%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ + Y+T++ + G + A ++ ++ ++G P +TY ++ G A +G+T +A
Sbjct: 410 CYPDIVTYNTMLTALCKDGKVEDAVEILNQLSSKGCSPVLITYNTVIDGLAKAGKTGKAI 469

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+L +++ T+ ++ L+ + EA ++ +G P+ T+ S+ GL
Sbjct: 470 KLLDEMRAKDLKPDTITYSSLVGGLSREGKVDEAIKFFHEFERMGIRPNAVTFNSIMLGL 529

Query: 81 RK 76
K
Sbjct: 530 CK 531



Score = 48.9 bits (115), Expect = 9e-06
Identities = 31/131 (23%), Positives = 57/131 (43%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ + Y+T++ +G + A ++ M R PD +TY L+ A +
Sbjct: 201 SPDVVTYNTILRSLCDSGKLKQAMEVLDRMLQRDCYPDVITYTILIEATCRDSGVGHAMK 260

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
L +++ G T+ V++ + R EA ++L M G P+ T+ + +
Sbjct: 261 LLDEMRDRGCTPDVVTYNVLVNGICKEGRLDEAIKFLNDMPSSGCQPNVITHNIILRSMC 320

Query: 78 KEGFGEDAEKV 46
G DAEK+
Sbjct: 321 STGRWMDAEKL 331


tr_hit_id A9TFE2
Definition tr|A9TFE2|A9TFE2_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 137
Score (bit) 84.3
E-value 3.0e-15
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912579|Adiantum capillus-veneris mRNA, clone:
YMU001_000020_E09.
(443 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TFE2|A9TFE2_PHYPA Predicted protein OS=Physcomitrella paten... 84 3e-15
tr|A9TCK1|A9TCK1_PHYPA Predicted protein (Fragment) OS=Physcomit... 84 5e-15
tr|Q0DEH2|Q0DEH2_ORYSJ Os06g0152500 protein OS=Oryza sativa subs... 83 8e-15
tr|B8B2Y8|B8B2Y8_ORYSI Putative uncharacterized protein OS=Oryza... 83 8e-15
tr|A3B8H0|A3B8H0_ORYSJ Putative uncharacterized protein OS=Oryza... 83 8e-15
tr|A7PUN6|A7PUN6_VITVI Chromosome chr7 scaffold_31, whole genome... 82 2e-14
tr|B8XWY7|B8XWY7_BRANA Restorer-of-fertility (Fragment) OS=Brass... 80 5e-14
tr|A9S042|A9S042_PHYPA Predicted protein OS=Physcomitrella paten... 80 7e-14
tr|Q6ZHK7|Q6ZHK7_ORYSJ Putative fertility restorer homologue OS=... 77 3e-13
tr|A3C121|A3C121_ORYSJ Putative uncharacterized protein OS=Oryza... 77 3e-13
tr|A2YLG1|A2YLG1_ORYSI Putative uncharacterized protein OS=Oryza... 77 3e-13
tr|Q2QXL4|Q2QXL4_ORYSJ Os12g0152600 protein OS=Oryza sativa subs... 77 4e-13
tr|A2ZI56|A2ZI56_ORYSI Putative uncharacterized protein OS=Oryza... 77 4e-13
tr|Q7XJ94|Q7XJ94_RAPSA Pentatricopeptide repeat-containing prote... 77 6e-13
tr|Q7X9T6|Q7X9T6_RAPSA Fertility restorer homologue A OS=Raphanu... 77 6e-13
tr|Q6ZC60|Q6ZC60_ORYSJ Os08g0110200 protein OS=Oryza sativa subs... 77 6e-13
tr|B8AW25|B8AW25_ORYSI Putative uncharacterized protein OS=Oryza... 77 6e-13
tr|Q6YS36|Q6YS36_ORYSJ Os07g0300200 protein OS=Oryza sativa subs... 76 9e-13
tr|B8AKZ5|B8AKZ5_ORYSI Putative uncharacterized protein OS=Oryza... 76 9e-13
tr|A3AD34|A3AD34_ORYSJ Putative uncharacterized protein OS=Oryza... 76 9e-13
tr|Q2HVJ3|Q2HVJ3_MEDTR Tetratricopeptide-like helical OS=Medicag... 75 2e-12
tr|Q1KUU7|Q1KUU7_9ROSI Putative uncharacterized protein OS=Cleom... 75 2e-12
tr|A7P5N8|A7P5N8_VITVI Chromosome chr4 scaffold_6, whole genome ... 75 2e-12
tr|B4FX75|B4FX75_MAIZE Putative uncharacterized protein OS=Zea m... 74 4e-12
tr|A7Q887|A7Q887_VITVI Chromosome chr14 scaffold_63, whole genom... 74 4e-12
tr|A7Q6Y4|A7Q6Y4_VITVI Chromosome chr12 scaffold_57, whole genom... 74 4e-12
tr|A7PXD8|A7PXD8_VITVI Chromosome chr12 scaffold_36, whole genom... 74 4e-12
tr|A7PDJ4|A7PDJ4_VITVI Chromosome chr17 scaffold_12, whole genom... 74 4e-12
tr|A5C6R8|A5C6R8_VITVI Putative uncharacterized protein OS=Vitis... 74 4e-12
tr|A5B3Q6|A5B3Q6_VITVI Putative uncharacterized protein OS=Vitis... 74 4e-12

>tr|A9TFE2|A9TFE2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_144816 PE=4 SV=1
Length = 621

Score = 84.3 bits (207), Expect = 3e-15
Identities = 46/137 (33%), Positives = 71/137 (51%), Gaps = 1/137 (0%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ Y++LIYG G+ G +Q A L+ EM+ G PD +TY L+ G G T +A
Sbjct: 145 CVPDTFTYNSLIYGLGKVGRSQKAMELLEEMERHGCPPDVMTYSSLITGLGKDGETVKAF 204

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+LF+++ + G+ + TF ++ L R +A + L M E G P TY ++ G
Sbjct: 205 KLFQEMKRRGRKPDSITFTALMDALGKAGRVDDALELLDEMKERGVKPGVVTYNALIAGF 264

Query: 81 RKEG-FGEDAEKVDEMQ 34
K G E +DEM+
Sbjct: 265 GKVGDLVEAYNLLDEMK 281



Score = 79.3 bits (194), Expect = 9e-14
Identities = 50/142 (35%), Positives = 73/142 (51%), Gaps = 1/142 (0%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C PN Y+TL+ G+AG A L+ EM G PD TY CL++ +GR ++A
Sbjct: 75 CKPNLWTYNTLVDCLGKAGQFDEALRLLAEMRDNGCVPDVRTYNCLISTLGKAGRLSEAF 134

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
LF ++ + G T+ ++ L V R+Q+A + L+ M G PD TY S+ GL
Sbjct: 135 TLFAEMRERGCVPDTFTYNSLIYGLGKVGRSQKAMELLEEMERHGCPPDVMTYSSLITGL 194

Query: 81 RKEGFGEDAEKV-DEMQLLARK 19
K+G A K+ EM+ RK
Sbjct: 195 GKDGETVKAFKLFQEMKRRGRK 216



Score = 75.5 bits (184), Expect = 1e-12
Identities = 48/144 (33%), Positives = 74/144 (51%), Gaps = 1/144 (0%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
+P+ + YS LI GRAG + A ++ EM A+G +P+ TY L+ +G+ +A +
Sbjct: 41 TPDVVSYSCLINSLGRAGKWEAALEVVAEMQAKGCKPNLWTYNTLVDCLGKAGQFDEALR 100

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
L ++ +G T+ ++ L R EAF M E G PDT+TY S+ GL
Sbjct: 101 LLAEMRDNGCVPDVRTYNCLISTLGKAGRLSEAFTLFAEMRERGCVPDTFTYNSLIYGLG 160

Query: 78 KEGFGEDA-EKVDEMQLLARKECP 10
K G + A E ++EM+ R CP
Sbjct: 161 KVGRSQKAMELLEEME---RHGCP 181



Score = 74.3 bits (181), Expect = 3e-12
Identities = 41/130 (31%), Positives = 71/130 (54%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P++I ++ L+ G+AG A L+ EM RG +P +TY L+AG+ G +A L
Sbjct: 217 PDSITFTALMDALGKAGRVDDALELLDEMKERGVKPGVVTYNALIAGFGKVGDLVEAYNL 276

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
+++ ++G T+ ++ L ++ EA Q L++M + G PDT TY ++ +GL K
Sbjct: 277 LDEMKRNGCKPDVVTYSCLITGLIKASQLDEACQVLKKMEKEGCPPDTITYNTLINGLGK 336

Query: 75 EGFGEDAEKV 46
G DA ++
Sbjct: 337 AGLLNDAGRL 346



Score = 72.8 bits (177), Expect = 8e-12
Identities = 46/137 (33%), Positives = 69/137 (50%), Gaps = 1/137 (0%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ Y+ LI G+AG A +L EM RG PD TY L+ G GR+ +A
Sbjct: 110 CVPDVRTYNCLISTLGKAGRLSEAFTLFAEMRERGCVPDTFTYNSLIYGLGKVGRSQKAM 169

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+L E++ + G T+ ++ L +AF+ Q M G PD+ T+ ++ D L
Sbjct: 170 ELLEEMERHGCPPDVMTYSSLITGLGKDGETVKAFKLFQEMKRRGRKPDSITFTALMDAL 229

Query: 81 RKEGFGEDA-EKVDEMQ 34
K G +DA E +DEM+
Sbjct: 230 GKAGRVDDALELLDEMK 246



Score = 68.9 bits (167), Expect = 1e-10
Identities = 42/144 (29%), Positives = 69/144 (47%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ + YS+LI G G+ G A L EM RG +PD +T+ L+ +GR A
Sbjct: 180 CPPDVMTYSSLITGLGKDGETVKAFKLFQEMKRRGRKPDSITFTALMDALGKAGRVDDAL 239

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+L +++ + G T+ ++ V EA+ L M G PD TY + GL
Sbjct: 240 ELLDEMKERGVKPGVVTYNALIAGFGKVGDLVEAYNLLDEMKRNGCKPDVVTYSCLITGL 299

Query: 81 RKEGFGEDAEKVDEMQLLARKECP 10
K ++A +V ++ + ++ CP
Sbjct: 300 IKASQLDEACQV--LKKMEKEGCP 321



Score = 68.6 bits (166), Expect = 2e-10
Identities = 38/132 (28%), Positives = 65/132 (49%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ + YS LI G +A A ++ +M+ G PD +TY L+ G +G A
Sbjct: 285 CKPDVVTYSCLITGLIKASQLDEACQVLKKMEKEGCPPDTITYNTLINGLGKAGLLNDAG 344

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+LF+++ G + T+ ++ L R + A + M +G PD +TY S+ L
Sbjct: 345 RLFDRMKSKGCNPDVVTYSTLITALGKAARVESACVLFEEMESVGIQPDLFTYCSIITVL 404

Query: 81 RKEGFGEDAEKV 46
K G +DA+++
Sbjct: 405 GKAGQVDDADRL 416



Score = 68.6 bits (166), Expect = 2e-10
Identities = 41/134 (30%), Positives = 63/134 (47%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ I Y+TLI G G+AG A L M ++G PD +TY L+ + R AC
Sbjct: 320 CPPDTITYNTLINGLGKAGLLNDAGRLFDRMKSKGCNPDVVTYSTLITALGKAARVESAC 379

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
LFE++ G T+ ++ L + +A + M G PD TY + + L
Sbjct: 380 VLFEEMESVGIQPDLFTYCSIITVLGKAGQVDDADRLFSEMRGKGLSPDVITYNAFLNSL 439

Query: 81 RKEGFGEDAEKVDE 40
+ G ++A K+ E
Sbjct: 440 GRGGRFKEARKIFE 453



Score = 67.8 bits (164), Expect = 3e-10
Identities = 37/127 (29%), Positives = 63/127 (49%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P + Y+ LI G G+ G+ A +L+ EM G +PD +TY CL+ G + + +ACQ+
Sbjct: 252 PGVVTYNALIAGFGKVGDLVEAYNLLDEMKRNGCKPDVVTYSCLITGLIKASQLDEACQV 311

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
+++ ++G T+ ++ L +A + RM G +PD TY ++ L K
Sbjct: 312 LKKMEKEGCPPDTITYNTLINGLGKAGLLNDAGRLFDRMKSKGCNPDVVTYSTLITALGK 371

Query: 75 EGFGEDA 55
E A
Sbjct: 372 AARVESA 378



Score = 67.0 bits (162), Expect = 4e-10
Identities = 41/129 (31%), Positives = 63/129 (48%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C+P+ + YSTLI G+A + A L EM++ G +PD TY ++ +G+ A
Sbjct: 355 CNPDVVTYSTLITALGKAARVESACVLFEEMESVGIQPDLFTYCSIITVLGKAGQVDDAD 414

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+LF ++ G T+ L L R +EA + + M E G PD TY ++ GL
Sbjct: 415 RLFSEMRGKGLSPDVITYNAFLNSLGRGGRFKEARKIFEDMKESGLLPDVATYDALLLGL 474

Query: 81 RKEGFGEDA 55
K +DA
Sbjct: 475 SKTKEVDDA 483



Score = 53.9 bits (128), Expect = 4e-06
Identities = 44/179 (24%), Positives = 70/179 (39%), Gaps = 36/179 (20%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ I Y+ + GR G + A+ + +M G PD TY LL G + + AC
Sbjct: 426 SPDVITYNAFLNSLGRGGRFKEARKIFEDMKESGLLPDVATYDALLLGLSKTKEVDDACG 485

Query: 258 LFEQVLQDG---------------------QHLH--------------AETFKVMLKHLA 184
L +++++ G H A ++ ++ LA
Sbjct: 486 LLKELIEQGCAFDSLKFDECLEILTSWGNVDEAHELLQFANSKGLWPGASSYNALIDALA 545

Query: 183 GVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKEGFGEDA-EKVDEMQLLARKECP 10
R EAF L+ + E G PD +Y S+ L + G + A E ++EM K P
Sbjct: 546 KAGRVSEAFNTLEDLKEQGGKPDIVSYSSLISALGQTGQIDTAFELLEEMSKRGLKLSP 604



Score = 52.8 bits (125), Expect = 9e-06
Identities = 33/130 (25%), Positives = 58/130 (44%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ Y ++I G+AG A L EM +G PD +TY L GR +A ++
Sbjct: 392 PDLFTYCSIITVLGKAGQVDDADRLFSEMRGKGLSPDVITYNAFLNSLGRGGRFKEARKI 451

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
FE + + G T+ +L L+ +A L+ ++E G D+ + + L
Sbjct: 452 FEDMKESGLLPDVATYDALLLGLSKTKEVDDACGLLKELIEQGCAFDSLKFDECLEILTS 511

Query: 75 EGFGEDAEKV 46
G ++A ++
Sbjct: 512 WGNVDEAHEL 521



Score = 38.5 bits (88), Expect = 0.17
Identities = 20/83 (24%), Positives = 43/83 (51%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P A Y+ LI +AG A + + ++ +G +PD ++Y L++ +G+ A +L
Sbjct: 532 PGASSYNALIDALAKAGRVSEAFNTLEDLKEQGGKPDIVSYSSLISALGQTGQIDTAFEL 591

Query: 255 FEQVLQDGQHLHAETFKVMLKHL 187
E++ + G L ++ +++ L
Sbjct: 592 LEEMSKRGLKLSPRSYSNLVRKL 614



Score = 36.6 bits (83), Expect = 0.63
Identities = 21/98 (21%), Positives = 43/98 (43%)
Frame = -3

Query: 387 GNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQVLQDGQHLHAETF 208
GN A L+ +++G P +Y L+ A +GR ++A E + + G ++
Sbjct: 513 GNVDEAHELLQFANSKGLWPGASSYNALIDALAKAGRVSEAFNTLEDLKEQGGKPDIVSY 572

Query: 207 KVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSV 94
++ L + AF+ L+ M + G +Y ++
Sbjct: 573 SSLISALGQTGQIDTAFELLEEMSKRGLKLSPRSYSNL 610


>tr|A9TCK1|A9TCK1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_220990 PE=4 SV=1
Length = 499

Score = 83.6 bits (205), Expect = 5e-15
Identities = 43/124 (34%), Positives = 71/124 (57%)
Frame = -3

Query: 426 IVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQ 247
+VY++LI+G GR+G A A L EM ++G +PD +T+ L+ G V+GR ++A ++F++
Sbjct: 230 VVYNSLIHGLGRSGRADAAAKLFREMLSKGLQPDHVTFTSLVYGLGVAGRASEARRIFQE 289

Query: 246 VLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKEGF 67
G L + V++ L R EA++ + E G PD +T+ ++ DGL K G
Sbjct: 290 ARDVGCALDVNLYNVLIDTLCKSKRLDEAWEIFGELEEDGLVPDVYTFNALMDGLCKSGR 349

Query: 66 GEDA 55
DA
Sbjct: 350 IHDA 353



Score = 76.3 bits (186), Expect = 7e-13
Identities = 45/136 (33%), Positives = 71/136 (52%), Gaps = 4/136 (2%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C+P+ VY+TLI G ++G + A L+LEM + G+EPD +TY L+ GR A
Sbjct: 365 CTPDVTVYNTLIDGLRKSGRVEEAGQLLLEMQSLGYEPDVVTYNTLIDESCKGGRIEDAL 424

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYL----QRMLELGFDPDTWTYKSV 94
+LFE++ G + T+ +L L R EA++ Q ++ DPD TY ++
Sbjct: 425 RLFEEISAKG-FANTVTYNTILNGLCMAGRVDEAYKLFNGMKQETVDGVIDPDFVTYTTL 483

Query: 93 NDGLRKEGFGEDAEKV 46
+G R+ G E A +
Sbjct: 484 LNGARQAGLSELANSL 499



Score = 71.2 bits (173), Expect = 2e-11
Identities = 41/132 (31%), Positives = 63/132 (47%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
CSPN I YS LI + G + A + L+M +RG P+ TY ++ G SG +A
Sbjct: 155 CSPNVITYSILIDAVCKCGGVEKALKVFLDMKSRGCRPNIFTYTSMIDGLGKSGHVDKAF 214

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
LFE++ +G + ++ L RA A + + ML G PD T+ S+ GL
Sbjct: 215 FLFEEMTSEGLVATRVVYNSLIHGLGRSGRADAAAKLFREMLSKGLQPDHVTFTSLVYGL 274

Query: 81 RKEGFGEDAEKV 46
G +A ++
Sbjct: 275 GVAGRASEARRI 286



Score = 65.1 bits (157), Expect = 2e-09
Identities = 44/137 (32%), Positives = 67/137 (48%), Gaps = 1/137 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + +++L+YG G AG A A+ + E G D Y L+ S R +A ++
Sbjct: 262 PDHVTFTSLVYGLGVAGRASEARRIFQEARDVGCALDVNLYNVLIDTLCKSKRLDEAWEI 321

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F ++ +DG TF ++ L R +AF L M G PD Y ++ DGLRK
Sbjct: 322 FGELEEDGLVPDVYTFNALMDGLCKSGRIHDAFILLGDMKRAGCTPDVTVYNTLIDGLRK 381

Query: 75 EGFGEDA-EKVDEMQLL 28
G E+A + + EMQ L
Sbjct: 382 SGRVEEAGQLLLEMQSL 398



Score = 54.3 bits (129), Expect = 3e-06
Identities = 38/134 (28%), Positives = 61/134 (45%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C+ + +Y+ LI ++ A + E++ G PD T+ L+ G SGR A
Sbjct: 295 CALDVNLYNVLIDTLCKSKRLDEAWEIFGELEEDGLVPDVYTFNALMDGLCKSGRIHDAF 354

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
L + + G + ++ L R +EA Q L M LG++PD TY ++ D
Sbjct: 355 ILLGDMKRAGCTPDVTVYNTLIDGLRKSGRVEEAGQLLLEMQSLGYEPDVVTYNTLIDES 414

Query: 81 RKEGFGEDAEKVDE 40
K G EDA ++ E
Sbjct: 415 CKGGRIEDALRLFE 428



Score = 53.9 bits (128), Expect = 4e-06
Identities = 33/129 (25%), Positives = 59/129 (45%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C+ A Y++LI +AG Q A ++ M G PD T+ L+ + + R
Sbjct: 85 CALTASAYNSLIDAFVKAGYTQKALAVYRVMGQSGLRPDTYTFNVLMNAFKKAKRVDSVW 144

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+LFE++ + T+ +++ + ++A + M G P+ +TY S+ DGL
Sbjct: 145 KLFEEMQNQNCSPNVITYSILIDAVCKCGGVEKALKVFLDMKSRGCRPNIFTYTSMIDGL 204

Query: 81 RKEGFGEDA 55
K G + A
Sbjct: 205 GKSGHVDKA 213



Score = 48.5 bits (114), Expect = 2e-04
Identities = 33/130 (25%), Positives = 60/130 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ ++ L+ G ++G A L+ +M G PD Y L+ G SGR +A QL
Sbjct: 332 PDVYTFNALMDGLCKSGRIHDAFILLGDMKRAGCTPDVTVYNTLIDGLRKSGRVEEAGQL 391

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
++ G T+ ++ R ++A + + + GF +T TY ++ +GL
Sbjct: 392 LLEMQSLGYEPDVVTYNTLIDESCKGGRIEDALRLFEEISAKGF-ANTVTYNTILNGLCM 450

Query: 75 EGFGEDAEKV 46
G ++A K+
Sbjct: 451 AGRVDEAYKL 460


>tr|Q0DEH2|Q0DEH2_ORYSJ Os06g0152500 protein OS=Oryza sativa subsp.
japonica GN=Os06g0152500 PE=4 SV=1
Length = 647

Score = 82.8 bits (203), Expect = 8e-15
Identities = 47/134 (35%), Positives = 76/134 (56%), Gaps = 1/134 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + Y+ LI G + G LA+ L+ EM+A+ +PD +TY +++GY G A QL
Sbjct: 308 PSVVCYNALINGYCKLGRMDLARELIREMEAKRVKPDVVTYSTIISGYCKVGNLDSAFQL 367

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
+++L+ G A T+ +++ L R +A + + ML+LG PD +TY ++ DG K
Sbjct: 368 NQKMLKKGVLPDAITYSSLIRGLCEEKRLNDACELFENMLQLGVQPDEFTYTTLIDGHCK 427

Query: 75 EGFGEDAEKV-DEM 37
EG E A + DEM
Sbjct: 428 EGNVEKALSLHDEM 441



Score = 66.2 bits (160), Expect = 7e-10
Identities = 39/130 (30%), Positives = 61/130 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + YST+I G + GN A L +M +G PD +TY L+ G R AC+L
Sbjct: 343 PDVVTYSTIISGYCKVGNLDSAFQLNQKMLKKGVLPDAITYSSLIRGLCEEKRLNDACEL 402

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
FE +LQ G T+ ++ ++A M+ G PD TY + +GL K
Sbjct: 403 FENMLQLGVQPDEFTYTTLIDGHCKEGNVEKALSLHDEMIRKGVLPDVVTYSVLINGLSK 462

Query: 75 EGFGEDAEKV 46
++A ++
Sbjct: 463 SARTKEAHRL 472



Score = 52.4 bits (124), Expect = 1e-05
Identities = 39/134 (29%), Positives = 59/134 (44%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
N + ++ LI G + G A + EM G +P + Y L+ GY GR A +L
Sbjct: 274 NEVTFTALIDGFCKKGFLDDALLAVEEMRKCGIQPSVVCYNALINGYCKLGRMDLARELI 333

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKE 73
++ T+ ++ V AFQ Q+ML+ G PD TY S+ GL +E
Sbjct: 334 REMEAKRVKPDVVTYSTIISGYCKVGNLDSAFQLNQKMLKKGVLPDAITYSSLIRGLCEE 393

Query: 72 GFGEDAEKVDEMQL 31
DA ++ E L
Sbjct: 394 KRLNDACELFENML 407



Score = 49.3 bits (116), Expect = 9e-05
Identities = 32/114 (28%), Positives = 53/114 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+AI YS+LI G A L M G +PD TY L+ G+ G +A L
Sbjct: 378 PDAITYSSLIRGLCEEKRLNDACELFENMLQLGVQPDEFTYTTLIDGHCKEGNVEKALSL 437

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSV 94
+++++ G T+ V++ L+ R +EA + L ++ PD Y ++
Sbjct: 438 HDEMIRKGVLPDVVTYSVLINGLSKSARTKEAHRLLFKLYHEDPVPDNIKYDAL 491



Score = 48.1 bits (113), Expect = 2e-04
Identities = 36/138 (26%), Positives = 68/138 (49%), Gaps = 2/138 (1%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARG-FEPDWLTYKCLLAGYAVSGRTAQA 265
C+PNA+ Y+TL+ RAG A+ ++ M G +P+ +T+ ++ G +GR A
Sbjct: 183 CAPNAVTYNTLVAAFCRAGELDGAERVVSLMREEGNAKPNLVTFNSMVNGLCKAGRMEGA 242

Query: 264 CQLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG 85
++F++++++G A + +M E G + T+ ++ DG
Sbjct: 243 RKVFDEMVREGL------------------APDVAVALVAQMRERGLRMNEVTFTALIDG 284

Query: 84 LRKEGFGEDA-EKVDEMQ 34
K+GF +DA V+EM+
Sbjct: 285 FCKKGFLDDALLAVEEMR 302



Score = 45.8 bits (107), Expect = 0.001
Identities = 33/144 (22%), Positives = 66/144 (45%), Gaps = 16/144 (11%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCL---------------L 301
P+ + YS LI G ++ + A L+ ++ PD + Y L L
Sbjct: 448 PDVVTYSVLINGLSKSARTKEAHRLLFKLYHEDPVPDNIKYDALMLCCSKAEFKSVVALL 507

Query: 300 AGYAVSGRTAQACQLFEQVLQDGQHLHAETFKVMLK-HLAGVNRAQEAFQYLQRMLELGF 124
G+ + G +A ++++ +L L + +++ H G N ++A + ++ML GF
Sbjct: 508 KGFCMKGLMKEADKVYQSMLDRNWKLDGSVYSILIHGHCRGGN-VRKALSFHKQMLRSGF 566

Query: 123 DPDTWTYKSVNDGLRKEGFGEDAE 52
P++ + S+ GL +EG +A+
Sbjct: 567 SPNSTSTISLVRGLFEEGMVVEAD 590



Score = 39.3 bits (90), Expect = 0.098
Identities = 30/152 (19%), Positives = 61/152 (40%), Gaps = 17/152 (11%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDW-----------------LTYKC 307
PN + +++++ G +AG + A+ + EM G PD +T+
Sbjct: 221 PNLVTFNSMVNGLCKAGRMEGARKVFDEMVREGLAPDVAVALVAQMRERGLRMNEVTFTA 280

Query: 306 LLAGYAVSGRTAQACQLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELG 127
L+ G+ G A E++ + G + ++ + R A + ++ M
Sbjct: 281 LIDGFCKKGFLDDALLAVEEMRKCGIQPSVVCYNALINGYCKLGRMDLARELIREMEAKR 340

Query: 126 FDPDTWTYKSVNDGLRKEGFGEDAEKVDEMQL 31
PD TY ++ G K G + A ++++ L
Sbjct: 341 VKPDVVTYSTIISGYCKVGNLDSAFQLNQKML 372



Score = 33.9 bits (76), Expect = 4.1
Identities = 23/76 (30%), Positives = 34/76 (44%)
Frame = -3

Query: 423 VYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQV 244
VYS LI+G R GN + A S +M GF P+ + L+ G G +A + +
Sbjct: 537 VYSILIHGHCRGGNVRKALSFHKQMLRSGFSPNSTSTISLVRGLFEEGMVVEADNAIQDL 596

Query: 243 LQDGQHLHAETFKVML 196
L AE K ++
Sbjct: 597 LTCCPLADAEASKALI 612


>tr|B8B2Y8|B8B2Y8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21710 PE=4 SV=1
Length = 694

Score = 82.8 bits (203), Expect = 8e-15
Identities = 47/134 (35%), Positives = 76/134 (56%), Gaps = 1/134 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + Y+ LI G + G LA+ L+ EM+A+ +PD +TY +++GY G A QL
Sbjct: 361 PSVVCYNALINGYCKLGRMDLARELIREMEAKRVKPDVVTYSTIISGYCKVGNLDSAFQL 420

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
+++L+ G A T+ +++ L R +A + + ML+LG PD +TY ++ DG K
Sbjct: 421 NQKMLKKGVLPDAITYSSLIRGLCEEKRLNDACELFENMLQLGVQPDEFTYTTLIDGHCK 480

Query: 75 EGFGEDAEKV-DEM 37
EG E A + DEM
Sbjct: 481 EGNVEKALSLHDEM 494



Score = 66.2 bits (160), Expect = 7e-10
Identities = 39/130 (30%), Positives = 61/130 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + YST+I G + GN A L +M +G PD +TY L+ G R AC+L
Sbjct: 396 PDVVTYSTIISGYCKVGNLDSAFQLNQKMLKKGVLPDAITYSSLIRGLCEEKRLNDACEL 455

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
FE +LQ G T+ ++ ++A M+ G PD TY + +GL K
Sbjct: 456 FENMLQLGVQPDEFTYTTLIDGHCKEGNVEKALSLHDEMIRKGVLPDVVTYSVLINGLSK 515

Query: 75 EGFGEDAEKV 46
++A ++
Sbjct: 516 SARTKEAHRL 525



Score = 62.4 bits (150), Expect = 1e-08
Identities = 37/135 (27%), Positives = 69/135 (51%), Gaps = 1/135 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN + +++++ G +AG + A+ + EM G PD ++Y LL+GY G ++ +
Sbjct: 221 PNLVTFNSMVNGLCKAGRMEGARKVFDEMVREGLAPDVVSYNTLLSGYCKVGCLHESLAV 280

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F ++ Q G TF ++ ++A + +M E G + T+ ++ DG K
Sbjct: 281 FSEMTQRGLVPDVVTFTSLIHATCKAGNLEQAVALVAQMRERGLRMNEVTFTALIDGFCK 340

Query: 75 EGFGEDA-EKVDEMQ 34
+GF +DA V+EM+
Sbjct: 341 KGFLDDALLAVEEMR 355



Score = 55.1 bits (131), Expect = 2e-06
Identities = 34/130 (26%), Positives = 63/130 (48%), Gaps = 1/130 (0%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARG-FEPDWLTYKCLLAGYAVSGRTAQA 265
C+PNA+ Y+TL+ RAG A+ ++ M G +P+ +T+ ++ G +GR A
Sbjct: 183 CAPNAVTYNTLVAAFCRAGELDGAERVVSLMREEGNAKPNLVTFNSMVNGLCKAGRMEGA 242

Query: 264 CQLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG 85
++F++++++G ++ +L V E+ M + G PD T+ S+
Sbjct: 243 RKVFDEMVREGLAPDVVSYNTLLSGYCKVGCLHESLAVFSEMTQRGLVPDVVTFTSLIHA 302

Query: 84 LRKEGFGEDA 55
K G E A
Sbjct: 303 TCKAGNLEQA 312



Score = 52.4 bits (124), Expect = 1e-05
Identities = 39/134 (29%), Positives = 59/134 (44%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
N + ++ LI G + G A + EM G +P + Y L+ GY GR A +L
Sbjct: 327 NEVTFTALIDGFCKKGFLDDALLAVEEMRKCGIQPSVVCYNALINGYCKLGRMDLARELI 386

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKE 73
++ T+ ++ V AFQ Q+ML+ G PD TY S+ GL +E
Sbjct: 387 REMEAKRVKPDVVTYSTIISGYCKVGNLDSAFQLNQKMLKKGVLPDAITYSSLIRGLCEE 446

Query: 72 GFGEDAEKVDEMQL 31
DA ++ E L
Sbjct: 447 KRLNDACELFENML 460



Score = 49.7 bits (117), Expect = 7e-05
Identities = 30/135 (22%), Positives = 63/135 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + +++LI+ +AGN + A +L+ +M RG + +T+ L+ G+ G A
Sbjct: 291 PDVVTFTSLIHATCKAGNLEQAVALVAQMRERGLRMNEVTFTALIDGFCKKGFLDDALLA 350

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
E++ + G + ++ + R A + ++ M PD TY ++ G K
Sbjct: 351 VEEMRKCGIQPSVVCYNALINGYCKLGRMDLARELIREMEAKRVKPDVVTYSTIISGYCK 410

Query: 75 EGFGEDAEKVDEMQL 31
G + A ++++ L
Sbjct: 411 VGNLDSAFQLNQKML 425



Score = 49.3 bits (116), Expect = 9e-05
Identities = 32/114 (28%), Positives = 53/114 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+AI YS+LI G A L M G +PD TY L+ G+ G +A L
Sbjct: 431 PDAITYSSLIRGLCEEKRLNDACELFENMLQLGVQPDEFTYTTLIDGHCKEGNVEKALSL 490

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSV 94
+++++ G T+ V++ L+ R +EA + L ++ PD Y ++
Sbjct: 491 HDEMIRKGVLPDVVTYSVLINGLSKSARTKEAHRLLFKLYHEDPVPDNIKYDAL 544



Score = 45.8 bits (107), Expect = 0.001
Identities = 33/144 (22%), Positives = 66/144 (45%), Gaps = 16/144 (11%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCL---------------L 301
P+ + YS LI G ++ + A L+ ++ PD + Y L L
Sbjct: 501 PDVVTYSVLINGLSKSARTKEAHRLLFKLYHEDPVPDNIKYDALMLCCSKAEFKSVVALL 560

Query: 300 AGYAVSGRTAQACQLFEQVLQDGQHLHAETFKVMLK-HLAGVNRAQEAFQYLQRMLELGF 124
G+ + G +A ++++ +L L + +++ H G N ++A + ++ML GF
Sbjct: 561 KGFCMKGLMKEADKVYQSMLDRNWKLDGSVYSILIHGHCRGGN-VRKALSFHKQMLRSGF 619

Query: 123 DPDTWTYKSVNDGLRKEGFGEDAE 52
P++ + S+ GL +EG +A+
Sbjct: 620 SPNSTSTISLVRGLFEEGMVVEAD 643



Score = 44.3 bits (103), Expect = 0.003
Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
+PN Y+ L+ G + A ++ +M G P+ +TY L+A + +G A +
Sbjct: 149 APNVYTYNILVRALCARGRLEEAVGVVGDMRGAGCAPNAVTYNTLVAAFCRAGELDGAER 208

Query: 258 LFEQVLQDGQ-HLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+ + ++G + TF M+ L R + A + M+ G PD +Y ++ G
Sbjct: 209 VVSLMREEGNAKPNLVTFNSMVNGLCKAGRMEGARKVFDEMVREGLAPDVVSYNTLLSGY 268

Query: 81 RKEG 70
K G
Sbjct: 269 CKVG 272



Score = 33.9 bits (76), Expect = 4.1
Identities = 23/76 (30%), Positives = 34/76 (44%)
Frame = -3

Query: 423 VYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQV 244
VYS LI+G R GN + A S +M GF P+ + L+ G G +A + +
Sbjct: 590 VYSILIHGHCRGGNVRKALSFHKQMLRSGFSPNSTSTISLVRGLFEEGMVVEADNAIQDL 649

Query: 243 LQDGQHLHAETFKVML 196
L AE K ++
Sbjct: 650 LTCCPLADAEASKALI 665


>tr|A3B8H0|A3B8H0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_019342 PE=4 SV=1
Length = 575

Score = 82.8 bits (203), Expect = 8e-15
Identities = 47/134 (35%), Positives = 76/134 (56%), Gaps = 1/134 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + Y+ LI G + G LA+ L+ EM+A+ +PD +TY +++GY G A QL
Sbjct: 219 PSVVCYNALINGYCKLGRMDLARELIREMEAKRVKPDVVTYSTIISGYCKVGNLDSAFQL 278

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
+++L+ G A T+ +++ L R +A + + ML+LG PD +TY ++ DG K
Sbjct: 279 NQKMLKKGVLPDAITYSSLIRGLCEEKRLNDACELFENMLQLGVQPDEFTYTTLIDGHCK 338

Query: 75 EGFGEDAEKV-DEM 37
EG E A + DEM
Sbjct: 339 EGNVEKALSLHDEM 352



Score = 66.2 bits (160), Expect = 7e-10
Identities = 39/130 (30%), Positives = 61/130 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + YST+I G + GN A L +M +G PD +TY L+ G R AC+L
Sbjct: 254 PDVVTYSTIISGYCKVGNLDSAFQLNQKMLKKGVLPDAITYSSLIRGLCEEKRLNDACEL 313

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
FE +LQ G T+ ++ ++A M+ G PD TY + +GL K
Sbjct: 314 FENMLQLGVQPDEFTYTTLIDGHCKEGNVEKALSLHDEMIRKGVLPDVVTYSVLINGLSK 373

Query: 75 EGFGEDAEKV 46
++A ++
Sbjct: 374 SARTKEAHRL 383



Score = 62.4 bits (150), Expect = 1e-08
Identities = 37/135 (27%), Positives = 69/135 (51%), Gaps = 1/135 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN + +++++ G +AG + A+ + EM G PD ++Y LL+GY G ++ +
Sbjct: 79 PNLVTFNSMVNGLCKAGRMEGARKVFDEMVREGLAPDVVSYNTLLSGYCKVGCLHESLAV 138

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F ++ Q G TF ++ ++A + +M E G + T+ ++ DG K
Sbjct: 139 FSEMTQRGLVPDVVTFTSLIHATCKAGNLEQAVALVAQMRERGLRMNEVTFTALIDGFCK 198

Query: 75 EGFGEDA-EKVDEMQ 34
+GF +DA V+EM+
Sbjct: 199 KGFLDDALLAVEEMR 213



Score = 55.1 bits (131), Expect = 2e-06
Identities = 34/130 (26%), Positives = 63/130 (48%), Gaps = 1/130 (0%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARG-FEPDWLTYKCLLAGYAVSGRTAQA 265
C+PNA+ Y+TL+ RAG A+ ++ M G +P+ +T+ ++ G +GR A
Sbjct: 41 CAPNAVTYNTLVAAFCRAGELDGAERVVSLMREEGNAKPNLVTFNSMVNGLCKAGRMEGA 100

Query: 264 CQLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG 85
++F++++++G ++ +L V E+ M + G PD T+ S+
Sbjct: 101 RKVFDEMVREGLAPDVVSYNTLLSGYCKVGCLHESLAVFSEMTQRGLVPDVVTFTSLIHA 160

Query: 84 LRKEGFGEDA 55
K G E A
Sbjct: 161 TCKAGNLEQA 170



Score = 52.4 bits (124), Expect = 1e-05
Identities = 39/134 (29%), Positives = 59/134 (44%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
N + ++ LI G + G A + EM G +P + Y L+ GY GR A +L
Sbjct: 185 NEVTFTALIDGFCKKGFLDDALLAVEEMRKCGIQPSVVCYNALINGYCKLGRMDLARELI 244

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKE 73
++ T+ ++ V AFQ Q+ML+ G PD TY S+ GL +E
Sbjct: 245 REMEAKRVKPDVVTYSTIISGYCKVGNLDSAFQLNQKMLKKGVLPDAITYSSLIRGLCEE 304

Query: 72 GFGEDAEKVDEMQL 31
DA ++ E L
Sbjct: 305 KRLNDACELFENML 318



Score = 49.7 bits (117), Expect = 7e-05
Identities = 30/135 (22%), Positives = 63/135 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + +++LI+ +AGN + A +L+ +M RG + +T+ L+ G+ G A
Sbjct: 149 PDVVTFTSLIHATCKAGNLEQAVALVAQMRERGLRMNEVTFTALIDGFCKKGFLDDALLA 208

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
E++ + G + ++ + R A + ++ M PD TY ++ G K
Sbjct: 209 VEEMRKCGIQPSVVCYNALINGYCKLGRMDLARELIREMEAKRVKPDVVTYSTIISGYCK 268

Query: 75 EGFGEDAEKVDEMQL 31
G + A ++++ L
Sbjct: 269 VGNLDSAFQLNQKML 283



Score = 49.3 bits (116), Expect = 9e-05
Identities = 32/114 (28%), Positives = 53/114 (46%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+AI YS+LI G A L M G +PD TY L+ G+ G +A L
Sbjct: 289 PDAITYSSLIRGLCEEKRLNDACELFENMLQLGVQPDEFTYTTLIDGHCKEGNVEKALSL 348

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSV 94
+++++ G T+ V++ L+ R +EA + L ++ PD Y ++
Sbjct: 349 HDEMIRKGVLPDVVTYSVLINGLSKSARTKEAHRLLFKLYHEDPVPDNIKYDAL 402



Score = 45.8 bits (107), Expect = 0.001
Identities = 33/144 (22%), Positives = 66/144 (45%), Gaps = 16/144 (11%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCL---------------L 301
P+ + YS LI G ++ + A L+ ++ PD + Y L L
Sbjct: 359 PDVVTYSVLINGLSKSARTKEAHRLLFKLYHEDPVPDNIKYDALMLCCSKAEFKSVVALL 418

Query: 300 AGYAVSGRTAQACQLFEQVLQDGQHLHAETFKVMLK-HLAGVNRAQEAFQYLQRMLELGF 124
G+ + G +A ++++ +L L + +++ H G N ++A + ++ML GF
Sbjct: 419 KGFCMKGLMKEADKVYQSMLDRNWKLDGSVYSILIHGHCRGGN-VRKALSFHKQMLRSGF 477

Query: 123 DPDTWTYKSVNDGLRKEGFGEDAE 52
P++ + S+ GL +EG +A+
Sbjct: 478 SPNSTSTISLVRGLFEEGMVVEAD 501



Score = 44.3 bits (103), Expect = 0.003
Identities = 30/124 (24%), Positives = 55/124 (44%), Gaps = 1/124 (0%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
+PN Y+ L+ G + A ++ +M G P+ +TY L+A + +G A +
Sbjct: 7 APNVYTYNILVRALCARGRLEEAVGVVGDMRGAGCAPNAVTYNTLVAAFCRAGELDGAER 66

Query: 258 LFEQVLQDGQ-HLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+ + ++G + TF M+ L R + A + M+ G PD +Y ++ G
Sbjct: 67 VVSLMREEGNAKPNLVTFNSMVNGLCKAGRMEGARKVFDEMVREGLAPDVVSYNTLLSGY 126

Query: 81 RKEG 70
K G
Sbjct: 127 CKVG 130



Score = 36.6 bits (83), Expect = 0.63
Identities = 31/112 (27%), Positives = 47/112 (41%), Gaps = 5/112 (4%)
Frame = -3

Query: 423 VYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQV 244
VYS LI+G R GN + A S +M GF P+ + L+ G G +A + +
Sbjct: 448 VYSILIHGHCRGGNVRKALSFHKQMLRSGFSPNSTSTISLVRGLFEEGMVVEADNAIQDL 507

Query: 243 LQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDT-----WTY 103
L AE K ++ +NR +E Y Q E+ + + W Y
Sbjct: 508 LTCCPLADAEASKALI----DLNR-KEGMDYFQAQGEIWYSESSPSVEYWNY 554


>tr|A7PUN6|A7PUN6_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023872001
PE=4 SV=1
Length = 660

Score = 81.6 bits (200), Expect = 2e-14
Identities = 44/127 (34%), Positives = 67/127 (52%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN + Y T+I + G K L LEM RG PD + Y ++ G +GR A L
Sbjct: 236 PNLVCYCTIIDSLCKDGLIDKGKELFLEMKGRGISPDVVAYSSIIHGMCHTGRWEGAKGL 295

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F +++ +G H + TF V++ L + +EA L+ M++ G PDT+TY ++ DG
Sbjct: 296 FNEMVDEGVHPNVVTFNVLIDALCKAGKMEEANHLLKLMIQRGESPDTFTYNTLIDGFCL 355

Query: 75 EGFGEDA 55
EG +DA
Sbjct: 356 EGRIDDA 362



Score = 60.1 bits (144), Expect = 5e-08
Identities = 36/128 (28%), Positives = 62/128 (48%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ Y+TLI G G A+ L + M+++G E D ++Y L+ GY SGR +A +
Sbjct: 340 SPDTFTYNTLIDGFCLEGRIDDARDLFVSMESKGIETDAVSYNVLINGYCKSGRMVEAKK 399

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
L+ +++ T+ +L L + ++A+ M P++ TY + DGL
Sbjct: 400 LYREMMCKEIMPTVITYNTLLTGLFREGKVRDAWNLFGEMKVHDLTPESCTYNILLDGLC 459

Query: 78 KEGFGEDA 55
K +A
Sbjct: 460 KNNHLSEA 467



Score = 59.7 bits (143), Expect = 7e-08
Identities = 38/127 (29%), Positives = 58/127 (45%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN + ++ LI +AG + A L+ M RG PD TY L+ G+ + GR A L
Sbjct: 306 PNVVTFNVLIDALCKAGKMEEANHLLKLMIQRGESPDTFTYNTLIDGFCLEGRIDDARDL 365

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F + G A ++ V++ R EA + + M+ P TY ++ GL +
Sbjct: 366 FVSMESKGIETDAVSYNVLINGYCKSGRMVEAKKLYREMMCKEIMPTVITYNTLLTGLFR 425

Query: 75 EGFGEDA 55
EG DA
Sbjct: 426 EGKVRDA 432



Score = 57.0 bits (136), Expect = 5e-07
Identities = 34/121 (28%), Positives = 58/121 (47%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ +++ LI G +A ++A+ L + G EP+ +TY ++ G SG+ A L
Sbjct: 481 PSIQIFNCLIDGLCKARKIEIARELFNRLSHEGLEPNVITYTVMIHGLCKSGQLENAKDL 540

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F + + G + TF +++ + Q+ + LQ M E F PD T V D L K
Sbjct: 541 FLGMEEKGCAPNLVTFNTLMRGFCQNDEMQKVVELLQEMAEKDFSPDASTISIVVDLLSK 600

Query: 75 E 73
+
Sbjct: 601 D 601



Score = 54.7 bits (130), Expect = 2e-06
Identities = 33/131 (25%), Positives = 61/131 (46%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ + YS++I+G G + AK L EM G P+ +T+ L+ +G+ +A
Sbjct: 270 SPDVVAYSSIIHGMCHTGRWEGAKGLFNEMVDEGVHPNVVTFNVLIDALCKAGKMEEANH 329

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
L + ++Q G+ T+ ++ R +A M G + D +Y + +G
Sbjct: 330 LLKLMIQRGESPDTFTYNTLIDGFCLEGRIDDARDLFVSMESKGIETDAVSYNVLINGYC 389

Query: 78 KEGFGEDAEKV 46
K G +A+K+
Sbjct: 390 KSGRMVEAKKL 400



Score = 54.7 bits (130), Expect = 2e-06
Identities = 35/128 (27%), Positives = 57/128 (44%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P I Y+TL+ G R G + A +L EM P+ TY LL G + ++A +L
Sbjct: 411 PTVITYNTLLTGLFREGKVRDAWNLFGEMKVHDLTPESCTYNILLDGLCKNNHLSEAMEL 470

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F + + F ++ L + + A + R+ G +P+ TY + GL K
Sbjct: 471 FHYLENHDFQPSIQIFNCLIDGLCKARKIEIARELFNRLSHEGLEPNVITYTVMIHGLCK 530

Query: 75 EGFGEDAE 52
G E+A+
Sbjct: 531 SGQLENAK 538



Score = 47.4 bits (111), Expect = 4e-04
Identities = 23/96 (23%), Positives = 49/96 (51%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN I Y+ +I+G ++G + AK L L M+ +G P+ +T+ L+ G+ + + +L
Sbjct: 516 PNVITYTVMIHGLCKSGQLENAKDLFLGMEEKGCAPNLVTFNTLMRGFCQNDEMQKVVEL 575

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYL 148
+++ + A T +++ L+ + +E L
Sbjct: 576 LQEMAEKDFSPDASTISIVVDLLSKDEKYREYLHLL 611



Score = 47.0 bits (110), Expect = 5e-04
Identities = 39/145 (26%), Positives = 61/145 (42%), Gaps = 12/145 (8%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SPN + +++L+ G A L+ +M G+ P+ +TY LL G ++G T A +
Sbjct: 159 SPNTVTFTSLVKGLCLGSRISEATGLLRKMVRMGYRPNVVTYGTLLNGLCMTGNTMLAVK 218

Query: 258 LFEQVLQDGQHLHAETFK-------VMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYK 100
L E++L +G T K ++ L + + M G PD Y
Sbjct: 219 LHEEML-NGNGGFGVTIKPNLVCYCTIIDSLCKDGLIDKGKELFLEMKGRGISPDVVAYS 277

Query: 99 SVNDGLRKEGFGEDA-----EKVDE 40
S+ G+ G E A E VDE
Sbjct: 278 SIIHGMCHTGRWEGAKGLFNEMVDE 302



Score = 42.7 bits (99), Expect = 0.009
Identities = 32/142 (22%), Positives = 65/142 (45%), Gaps = 1/142 (0%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
+P + Y+ L+ G + + A L ++ F+P + CL+ G + + A +
Sbjct: 445 TPESCTYNILLDGLCKNNHLSEAMELFHYLENHDFQPSIQIFNCLIDGLCKARKIEIARE 504

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
LF ++ +G + T+ VM+ L + + A M E G P+ T+ ++ G
Sbjct: 505 LFNRLSHEGLEPNVITYTVMIHGLCKSGQLENAKDLFLGMEEKGCAPNLVTFNTLMRGFC 564

Query: 78 KEGFGEDAEKVDE-MQLLARKE 16
+ ++ +KV E +Q +A K+
Sbjct: 565 Q---NDEMQKVVELLQEMAEKD 583


>tr|B8XWY7|B8XWY7_BRANA Restorer-of-fertility (Fragment) OS=Brassica
napus GN=PPR-B-L1 PE=2 SV=1
Length = 667

Score = 80.1 bits (196), Expect = 5e-14
Identities = 45/141 (31%), Positives = 73/141 (51%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN ++YS +I G + G A++L EM +G P+ TY C++ G+ SGR ++A +L
Sbjct: 246 PNVVIYSAIIDGLWKDGRQTDAQNLFSEMQEKGISPNLFTYNCMINGFCSSGRWSEAQRL 305

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
++ + TF V++ L + EA + ML G P+T TY S+ DG K
Sbjct: 306 LREMFERKMSPDVVTFSVLINALVKEGKFFEAEELYNEMLPRGIIPNTITYNSMIDGFSK 365

Query: 75 EGFGEDAEKVDEMQLLARKEC 13
+ + AE++ L+A K C
Sbjct: 366 QNRLDAAERM--FYLMATKGC 384



Score = 63.5 bits (153), Expect = 5e-09
Identities = 42/140 (30%), Positives = 69/140 (49%), Gaps = 11/140 (7%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
N I Y+TLI+G + GN A L+ EM + G P+ +T LL G +G+ A ++F
Sbjct: 422 NTITYTTLIHGFCQLGNLNAALDLLQEMISSGVCPNVVTCNTLLDGLCNNGKLKDALEMF 481

Query: 252 EQVLQDGQHLHA-----------ETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWT 106
+ + + L A +T+ +++ L + EA + + M G PDT T
Sbjct: 482 KVMQKSKMDLDASHPFNDVEPDVQTYNILICGLINEGKFSEAEELYEEMPHRGLVPDTIT 541

Query: 105 YKSVNDGLRKEGFGEDAEKV 46
Y SV DGL K+ ++A ++
Sbjct: 542 YNSVIDGLCKQSRLDEATQM 561



Score = 58.5 bits (140), Expect = 2e-07
Identities = 32/118 (27%), Positives = 57/118 (48%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ I Y+++I G + A + M ++GF PD +T+ L+ GY GR ++
Sbjct: 537 PDTITYNSVIDGLCKQSRLDEATQMFDSMGSKGFSPDVVTFTTLINGYCKVGRVGDGLEV 596

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
F ++ + G +A T++ ++ V A Q M+ G PDT T +++ GL
Sbjct: 597 FCEMGRRGIVANAITYRTLIHGFCQVGNINGALDIFQEMISSGVYPDTITIRNMLTGL 654



Score = 57.4 bits (137), Expect = 3e-07
Identities = 39/135 (28%), Positives = 64/135 (47%), Gaps = 2/135 (1%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMD-ARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
PN I Y T++ G + G+ A +L+ +M+ +P+ + Y ++ G GR A
Sbjct: 210 PNQITYGTIVDGMCKMGDTVSALNLLRKMEEVSRIKPNVVIYSAIIDGLWKDGRQTDAQN 269

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
LF ++ + G + T+ M+ R EA + L+ M E PD T+ + + L
Sbjct: 270 LFSEMQEKGISPNLFTYNCMINGFCSSGRWSEAQRLLREMFERKMSPDVVTFSVLINALV 329

Query: 78 KEG-FGEDAEKVDEM 37
KEG F E E +EM
Sbjct: 330 KEGKFFEAEELYNEM 344



Score = 56.2 bits (134), Expect = 8e-07
Identities = 32/127 (25%), Positives = 57/127 (44%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
PN I Y+++I G + A+ + M +G PD +T+ L+ GY + R +L
Sbjct: 351 PNTITYNSMIDGFSKQNRLDAAERMFYLMATKGCSPDVITFSILIDGYCGAKRVDDGMKL 410

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
++ + G + T+ ++ + A LQ M+ G P+ T ++ DGL
Sbjct: 411 LHEMSRRGLVANTITYTTLIHGFCQLGNLNAALDLLQEMISSGVCPNVVTCNTLLDGLCN 470

Query: 75 EGFGEDA 55
G +DA
Sbjct: 471 NGKLKDA 477



Score = 52.0 bits (123), Expect = 1e-05
Identities = 33/118 (27%), Positives = 54/118 (45%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SPN Y+ +I G +G A+ L+ EM R PD +T+ L+ G+ +A +
Sbjct: 280 SPNLFTYNCMINGFCSSGRWSEAQRLLREMFERKMSPDVVTFSVLINALVKEGKFFEAEE 339

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG 85
L+ ++L G + T+ M+ + NR A + M G PD T+ + DG
Sbjct: 340 LYNEMLPRGIIPNTITYNSMIDGFSKQNRLDAAERMFYLMATKGCSPDVITFSILIDG 397



Score = 51.6 bits (122), Expect = 2e-05
Identities = 32/123 (26%), Positives = 55/123 (44%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ + +S LI + G A+ L EM RG P+ +TY ++ G++ R A +
Sbjct: 315 SPDVVTFSVLINALVKEGKFFEAEELYNEMLPRGIIPNTITYNSMIDGFSKQNRLDAAER 374

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLR 79
+F + G TF +++ G R + + L M G +T TY ++ G
Sbjct: 375 MFYLMATKGCSPDVITFSILIDGYCGAKRVDDGMKLLHEMSRRGLVANTITYTTLIHGFC 434

Query: 78 KEG 70
+ G
Sbjct: 435 QLG 437



Score = 50.1 bits (118), Expect = 6e-05
Identities = 40/145 (27%), Positives = 65/145 (44%), Gaps = 12/145 (8%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLM-------LEMDA----RGFEPDWLTYKCLLAGYA 289
PN + +TL+ G G + A + +++DA EPD TY L+ G
Sbjct: 456 PNVVTCNTLLDGLCNNGKLKDALEMFKVMQKSKMDLDASHPFNDVEPDVQTYNILICGLI 515

Query: 288 VSGRTAQACQLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTW 109
G+ ++A +L+E++ G T+ ++ L +R EA Q M GF PD
Sbjct: 516 NEGKFSEAEELYEEMPHRGLVPDTITYNSVIDGLCKQSRLDEATQMFDSMGSKGFSPDVV 575

Query: 108 TYKSVNDGLRKEG-FGEDAEKVDEM 37
T+ ++ +G K G G+ E EM
Sbjct: 576 TFTTLINGYCKVGRVGDGLEVFCEM 600



Score = 49.7 bits (117), Expect = 7e-05
Identities = 32/122 (26%), Positives = 51/122 (41%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ Y+ LI G G A+ L EM RG PD +TY ++ G R +A Q+
Sbjct: 502 PDVQTYNILICGLINEGKFSEAEELYEEMPHRGLVPDTITYNSVIDGLCKQSRLDEATQM 561

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F+ + G TF ++ V R + + M G + TY+++ G +
Sbjct: 562 FDSMGSKGFSPDVVTFTTLINGYCKVGRVGDGLEVFCEMGRRGIVANAITYRTLIHGFCQ 621

Query: 75 EG 70
G
Sbjct: 622 VG 623



Score = 45.4 bits (106), Expect = 0.001
Identities = 26/97 (26%), Positives = 45/97 (46%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
SP+ + ++TLI G + G + EM RG + +TY+ L+ G+ G A
Sbjct: 571 SPDVVTFTTLINGYCKVGRVGDGLEVFCEMGRRGIVANAITYRTLIHGFCQVGNINGALD 630

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYL 148
+F++++ G + T + ML L + A Q L
Sbjct: 631 IFQEMISSGVYPDTITIRNMLTGLWSKEELKRAVQCL 667


>tr|A9S042|A9S042_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_162062 PE=4 SV=1
Length = 1043

Score = 79.7 bits (195), Expect = 7e-14
Identities = 41/124 (33%), Positives = 63/124 (50%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
CSPN + Y+TL+ G +AG + A + +EM PD + Y L+ G +G AC
Sbjct: 353 CSPNVVTYTTLVNGLAKAGRLEEACEVFVEMKENNCSPDAIAYNTLIDGLGKAGEADMAC 412

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
LF+++ G + T+ +M+ L R EA+Q + E G PD +TY ++ D L
Sbjct: 413 GLFKEMKDRGLVPNLRTYNIMISVLGKAGRQPEAWQLFHDLKEQGAVPDVFTYNTLIDVL 472

Query: 81 RKEG 70
K G
Sbjct: 473 GKGG 476



Score = 70.9 bits (172), Expect = 3e-11
Identities = 39/133 (29%), Positives = 68/133 (51%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P + Y+TL+ G G+AG A SL+ EM+ +G EP +TY L+A + + ++
Sbjct: 559 CIPTVVTYTTLVDGLGKAGRLDEAVSLLREMEKQGCEPSVVTYSSLMASFYKRDQEEESL 618

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
LF+++++ G T+ +++ L + +A RM E G +P YK++ L
Sbjct: 619 SLFDEMVRKGCVADVSTYSLVINCLCKSDDVDQALDVFGRMKEEGMEPLLGNYKTLLSSL 678

Query: 81 RKEGFGEDAEKVD 43
K+ EK+D
Sbjct: 679 VKD------EKID 685



Score = 68.9 bits (167), Expect = 1e-10
Identities = 46/137 (33%), Positives = 69/137 (50%), Gaps = 1/137 (0%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C+PN VYS+LI G+ G A L EM R P+ +TY LL+G A +GR A
Sbjct: 839 CTPNVGVYSSLIDSFGKKGMVDRALELFEEMQRRQCPPNIVTYNNLLSGLAKAGRLNVAE 898

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+L E++ + G T+ +++ + + EA Y +RM E G PD T+ S+ + L
Sbjct: 899 KLLEEMEKVGCVPDLVTYNILIDGVGKMGMVDEAESYFKRMKEKGIVPDVITFTSLIESL 958

Query: 81 RK-EGFGEDAEKVDEMQ 34
K + E E D M+
Sbjct: 959 GKVDKLLEACELFDSME 975



Score = 68.9 bits (167), Expect = 1e-10
Identities = 39/132 (29%), Positives = 66/132 (50%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C PN + Y+ L+ G +AG +A+ L+ EM+ G PD +TY L+ G G +A
Sbjct: 874 CPPNIVTYNNLLSGLAKAGRLNVAEKLLEEMEKVGCVPDLVTYNILIDGVGKMGMVDEAE 933

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
F+++ + G TF +++ L V++ EA + M E G++P TY + D L
Sbjct: 934 SYFKRMKEKGIVPDVITFTSLIESLGKVDKLLEACELFDSMEEEGYNPSVVTYNVLIDIL 993

Query: 81 RKEGFGEDAEKV 46
+ G +A +
Sbjct: 994 GRAGKVHEAAMI 1005



Score = 65.5 bits (158), Expect = 1e-09
Identities = 35/105 (33%), Positives = 55/105 (52%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
CSP+AI Y+TLI G G+AG A +A L EM RG P+ TY +++ +GR +A
Sbjct: 388 CSPDAIAYNTLIDGLGKAGEADMACGLFKEMKDRGLVPNLRTYNIMISVLGKAGRQPEAW 447

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELG 127
QLF + + G T+ ++ L + + ++ M+E G
Sbjct: 448 QLFHDLKEQGAVPDVFTYNTLIDVLGKGGQMDKVLAIIKEMVEKG 492



Score = 63.2 bits (152), Expect = 6e-09
Identities = 37/143 (25%), Positives = 69/143 (48%), Gaps = 1/143 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ Y++L+ G G++G + A ++ +M G EPD + Y L+ G+ + A +
Sbjct: 736 PDLFTYTSLLDGLGKSGRLEEAFNMFTKMTEEGHEPDVVAYTSLMDVLGKGGKLSHALII 795

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F + + T+ ++ L R +EA+ + + + G P+ Y S+ D K
Sbjct: 796 FRAMAKKRCVPDVVTYSSLIDSLGKEGRVEEAYYFFENSISKGCTPNVGVYSSLIDSFGK 855

Query: 75 EGFGEDA-EKVDEMQLLARKECP 10
+G + A E +EMQ R++CP
Sbjct: 856 KGMVDRALELFEEMQ---RRQCP 875



Score = 60.5 bits (145), Expect = 4e-08
Identities = 37/130 (28%), Positives = 63/130 (48%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ + YS+LI G+ G + A ++G P+ Y L+ + G +A
Sbjct: 804 CVPDVVTYSSLIDSLGKEGRVEEAYYFFENSISKGCTPNVGVYSSLIDSFGKKGMVDRAL 863

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+LFE++ + + T+ +L LA R A + L+ M ++G PD TY + DG+
Sbjct: 864 ELFEEMQRRQCPPNIVTYNNLLSGLAKAGRLNVAEKLLEEMEKVGCVPDLVTYNILIDGV 923

Query: 81 RKEGFGEDAE 52
K G ++AE
Sbjct: 924 GKMGMVDEAE 933



Score = 58.5 bits (140), Expect = 2e-07
Identities = 30/109 (27%), Positives = 51/109 (46%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ + Y+ LI G G+ G A+S M +G PD +T+ L+ + +AC
Sbjct: 909 CVPDLVTYNILIDGVGKMGMVDEAESYFKRMKEKGIVPDVITFTSLIESLGKVDKLLEAC 968

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPD 115
+LF+ + ++G + T+ V++ L + EA M G PD
Sbjct: 969 ELFDSMEEEGYNPSVVTYNVLIDILGRAGKVHEAAMIFHEMKVKGCMPD 1017



Score = 56.2 bits (134), Expect = 8e-07
Identities = 35/127 (27%), Positives = 57/127 (44%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ VY+ ++ G ++ A L+ M + PD TY LL G SGR +A +
Sbjct: 701 PDTFVYNIMVNGLVKSNRVDEACKLVDSMKNQNILPDLFTYTSLLDGLGKSGRLEEAFNM 760

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F ++ ++G + ++ L + A + M + PD TY S+ D L K
Sbjct: 761 FTKMTEEGHEPDVVAYTSLMDVLGKGGKLSHALIIFRAMAKKRCVPDVVTYSSLIDSLGK 820

Query: 75 EGFGEDA 55
EG E+A
Sbjct: 821 EGRVEEA 827



Score = 50.8 bits (120), Expect = 3e-05
Identities = 36/137 (26%), Positives = 61/137 (44%), Gaps = 1/137 (0%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C P+ + YS+L+ + + + SL EM +G D TY ++ S QA
Sbjct: 594 CEPSVVTYSSLMASFYKRDQEEESLSLFDEMVRKGCVADVSTYSLVINCLCKSDDVDQAL 653

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+F ++ ++G +K +L L + A Q + E PDT+ Y + +GL
Sbjct: 654 DVFGRMKEEGMEPLLGNYKTLLSSLVKDEKIDFALQIFNELQESSLVPDTFVYNIMVNGL 713

Query: 81 RKEGFGEDAEK-VDEMQ 34
K ++A K VD M+
Sbjct: 714 VKSNRVDEACKLVDSMK 730



Score = 50.8 bits (120), Expect = 3e-05
Identities = 35/129 (27%), Positives = 55/129 (42%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C + YS +I ++ + A + M G EP YK LL+ + A
Sbjct: 629 CVADVSTYSLVINCLCKSDDVDQALDVFGRMKEEGMEPLLGNYKTLLSSLVKDEKIDFAL 688

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
Q+F ++ + + +M+ L NR EA + + M PD +TY S+ DGL
Sbjct: 689 QIFNELQESSLVPDTFVYNIMVNGLVKSNRVDEACKLVDSMKNQNILPDLFTYTSLLDGL 748

Query: 81 RKEGFGEDA 55
K G E+A
Sbjct: 749 GKSGRLEEA 757



Score = 47.0 bits (110), Expect = 5e-04
Identities = 31/132 (23%), Positives = 62/132 (46%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C+P+ +Y+ ++ + G A + ++ +PD T++ + + SGR A
Sbjct: 248 CNPSTNMYNFVLELLVKGGFYHSAVIVFGKLGQFRIQPDAQTFRIFVHSFNRSGRLDPAA 307

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
+ +++++ G TF V++ L EA ++ M L P+ TY ++ +GL
Sbjct: 308 EPIQEMIKSGIDPGVHTFTVLIDALVKSGNIDEACKFFNGMKNLRCSPNVVTYTTLVNGL 367

Query: 81 RKEGFGEDAEKV 46
K G E+A +V
Sbjct: 368 AKAGRLEEACEV 379



Score = 47.0 bits (110), Expect = 5e-04
Identities = 32/135 (23%), Positives = 56/135 (41%), Gaps = 1/135 (0%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P+ + Y++L+ G+ G A + M + PD +TY L+ GR +A
Sbjct: 771 PDVVAYTSLMDVLGKGGKLSHALIIFRAMAKKRCVPDVVTYSSLIDSLGKEGRVEEAYYF 830

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
FE + G + + ++ A + + M P+ TY ++ GL K
Sbjct: 831 FENSISKGCTPNVGVYSSLIDSFGKKGMVDRALELFEEMQRRQCPPNIVTYNNLLSGLAK 890

Query: 75 EGFGEDAEK-VDEMQ 34
G AEK ++EM+
Sbjct: 891 AGRLNVAEKLLEEME 905



Score = 43.9 bits (102), Expect = 0.004
Identities = 30/122 (24%), Positives = 52/122 (42%)
Frame = -3

Query: 435 PNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQL 256
P ++ LI ++GN A M P+ +TY L+ G A +GR +AC++
Sbjct: 320 PGVHTFTVLIDALVKSGNIDEACKFFNGMKNLRCSPNVVTYTTLVNGLAKAGRLEEACEV 379

Query: 255 FEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
F ++ ++ A + ++ L A A + M + G P+ TY + L K
Sbjct: 380 FVEMKENNCSPDAIAYNTLIDGLGKAGEADMACGLFKEMKDRGLVPNLRTYNIMISVLGK 439

Query: 75 EG 70
G
Sbjct: 440 AG 441



Score = 38.1 bits (87), Expect = 0.22
Identities = 30/123 (24%), Positives = 52/123 (42%)
Frame = -3

Query: 417 STLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQVLQ 238
++L+ G N A + +M + G P Y +L G A +F ++ Q
Sbjct: 221 TSLLRTFGSTNNVSGALEIFNQMKSFGCNPSTNMYNFVLELLVKGGFYHSAVIVFGKLGQ 280

Query: 237 DGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKEGFGED 58
A+TF++ + R A + +Q M++ G DP T+ + D L K G ++
Sbjct: 281 FRIQPDAQTFRIFVHSFNRSGRLDPAAEPIQEMIKSGIDPGVHTFTVLIDALVKSGNIDE 340

Query: 57 AEK 49
A K
Sbjct: 341 ACK 343



Score = 36.2 bits (82), Expect = 0.83
Identities = 28/117 (23%), Positives = 48/117 (41%)
Frame = -3

Query: 426 IVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQ 247
I Y+TL+ G+ A L+ M P +TY L+ G +GR +A L +
Sbjct: 529 ITYNTLMSAFIHNGHVDEAVKLLEVMKKHECIPTVVTYTTLVDGLGKAGRLDEAVSLLRE 588

Query: 246 VLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRK 76
+ + G T+ ++ ++ +E+ M+ G D TY V + L K
Sbjct: 589 MEKQGCEPSVVTYSSLMASFYKRDQEEESLSLFDEMVRKGCVADVSTYSLVINCLCK 645


>tr|Q6ZHK7|Q6ZHK7_ORYSJ Putative fertility restorer homologue
OS=Oryza sativa subsp. japonica GN=OJ1218_C12.18 PE=4
SV=1
Length = 657

Score = 77.4 bits (189), Expect = 3e-13
Identities = 44/133 (33%), Positives = 71/133 (53%), Gaps = 1/133 (0%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
NAI Y++LI G G+AG +K L EM A+GF PD Y L+ G A SGR AC L+
Sbjct: 434 NAIFYTSLIDGFGKAGMVDQSKELFEEMIAKGFVPDSYCYNVLIDGLAKSGRMDDACALY 493

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKE 73
+++ DG T+ +++ L ++ +EA ++ M++ G P ++++ GL
Sbjct: 494 KRMEDDGCDQTVYTYTILIDGLFKEHKNEEALKFWDAMIDKGITPTAAAFRTLASGLCLS 553

Query: 72 G-FGEDAEKVDEM 37
G F +DE+
Sbjct: 554 GKFSRACRILDEL 566



Score = 56.6 bits (135), Expect = 6e-07
Identities = 33/129 (25%), Positives = 60/129 (46%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C+ NA +Y+ LI G+ G + A +L M G + D +TY ++ G+ +A
Sbjct: 361 CAANAAIYTALIDSMGKFGREKEAMALFERMKDSGLKLDSVTYGVIVNCLCRFGKLDEAV 420

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
F + G ++A + ++ ++ + + M+ GF PD++ Y + DGL
Sbjct: 421 ACFRSCQEKGIAVNAIFYTSLIDGFGKAGMVDQSKELFEEMIAKGFVPDSYCYNVLIDGL 480

Query: 81 RKEGFGEDA 55
K G +DA
Sbjct: 481 AKSGRMDDA 489



Score = 41.6 bits (96), Expect = 0.020
Identities = 30/130 (23%), Positives = 58/130 (44%), Gaps = 2/130 (1%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPD--WLTYKCLLAGYAVSGRTAQA 265
+P+ + Y TL+ G + L EM+ RG D Y ++ G+ +
Sbjct: 290 TPDKVTYLTLMQCHYSEGTFPVCIGLFQEMEERGMGNDIPQHAYVLVIGALCKDGKPFEG 349

Query: 264 CQLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG 85
+FE++L+ G +A + ++ + R +EA +RM + G D+ TY + +
Sbjct: 350 MAVFERMLKRGCAANAAIYTALIDSMGKFGREKEAMALFERMKDSGLKLDSVTYGVIVNC 409

Query: 84 LRKEGFGEDA 55
L + G ++A
Sbjct: 410 LCRFGKLDEA 419



Score = 36.2 bits (82), Expect = 0.83
Identities = 27/96 (28%), Positives = 40/96 (41%), Gaps = 2/96 (2%)
Frame = -3

Query: 351 MDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQV-LQDGQHLHAETFKVMLKHLAGVN 175
M G EP L Y CLL G +G A +F+ + +D ++ +++K
Sbjct: 212 MRLAGVEPSRLIYNCLLDGLVNAGLLDTAVNVFDAMSTEDQVRPDVVSYNILIKGYCRAG 271

Query: 174 RAQEAFQYLQRMLELG-FDPDTWTYKSVNDGLRKEG 70
RA +A L M E PD TY ++ EG
Sbjct: 272 RAHDAMARLSEMQEQAKLTPDKVTYLTLMQCHYSEG 307



Score = 35.0 bits (79), Expect = 1.8
Identities = 22/106 (20%), Positives = 48/106 (45%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQ 259
+P A + TL G +G A ++ E+ G P+ ++ ++ +GR QAC+
Sbjct: 537 TPTAAAFRTLASGLCLSGKFSRACRILDELAPMGVIPE-TAHEDMINVLCKAGRFKQACK 595

Query: 258 LFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFD 121
L + ++Q G+ + +M+ L A + + + +G++
Sbjct: 596 LADGIVQKGREIPGRVRTMMINALRKAGNTDLAVKLVHSKIGIGYE 641



Score = 33.9 bits (76), Expect = 4.1
Identities = 28/135 (20%), Positives = 58/135 (42%), Gaps = 3/135 (2%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C Y+ LI G + + A M +G P ++ L +G +SG+ ++AC
Sbjct: 501 CDQTVYTYTILIDGLFKEHKNEEALKFWDAMIDKGITPTAAAFRTLASGLCLSGKFSRAC 560

Query: 261 QLFEQVLQDG---QHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVN 91
++ +++ G + H + V+ K R ++A + +++ G + +
Sbjct: 561 RILDELAPMGVIPETAHEDMINVLCK----AGRFKQACKLADGIVQKGREIPGRVRTMMI 616

Query: 90 DGLRKEGFGEDAEKV 46
+ LRK G + A K+
Sbjct: 617 NALRKAGNTDLAVKL 631


>tr|A3C121|A3C121_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_028993 PE=4 SV=1
Length = 651

Score = 77.4 bits (189), Expect = 3e-13
Identities = 44/133 (33%), Positives = 71/133 (53%), Gaps = 1/133 (0%)
Frame = -3

Query: 432 NAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQACQLF 253
NAI Y++LI G G+AG +K L EM A+GF PD Y L+ G A SGR AC L+
Sbjct: 480 NAIFYTSLIDGFGKAGMVDQSKELFEEMIAKGFVPDSYCYNVLIDGLAKSGRMDDACALY 539

Query: 252 EQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGLRKE 73
+++ DG T+ +++ L ++ +EA ++ M++ G P ++++ GL
Sbjct: 540 KRMEDDGCDQTVYTYTILIDGLFKEHKNEEALKFWDAMIDKGITPTAAAFRTLASGLCLS 599

Query: 72 G-FGEDAEKVDEM 37
G F +DE+
Sbjct: 600 GKFSRACRILDEL 612



Score = 56.6 bits (135), Expect = 6e-07
Identities = 33/129 (25%), Positives = 60/129 (46%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C+ NA +Y+ LI G+ G + A +L M G + D +TY ++ G+ +A
Sbjct: 407 CAANAAIYTALIDSMGKFGREKEAMALFERMKDSGLKLDSVTYGVIVNCLCRFGKLDEAV 466

Query: 261 QLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDGL 82
F + G ++A + ++ ++ + + M+ GF PD++ Y + DGL
Sbjct: 467 ACFRSCQEKGIAVNAIFYTSLIDGFGKAGMVDQSKELFEEMIAKGFVPDSYCYNVLIDGL 526

Query: 81 RKEGFGEDA 55
K G +DA
Sbjct: 527 AKSGRMDDA 535



Score = 41.6 bits (96), Expect = 0.020
Identities = 30/130 (23%), Positives = 58/130 (44%), Gaps = 2/130 (1%)
Frame = -3

Query: 438 SPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPD--WLTYKCLLAGYAVSGRTAQA 265
+P+ + Y TL+ G + L EM+ RG D Y ++ G+ +
Sbjct: 336 TPDKVTYLTLMQCHYSEGTFPVCIGLFQEMEERGMGNDIPQHAYVLVIGALCKDGKPFEG 395

Query: 264 CQLFEQVLQDGQHLHAETFKVMLKHLAGVNRAQEAFQYLQRMLELGFDPDTWTYKSVNDG 85
+FE++L+ G +A + ++ + R +EA +RM + G D+ TY + +
Sbjct: 396 MAVFERMLKRGCAANAAIYTALIDSMGKFGREKEAMALFERMKDSGLKLDSVTYGVIVNC 455

Query: 84 LRKEGFGEDA 55
L + G ++A
Sbjct: 456 LCRFGKLDEA 465



Score = 36.2 bits (82), Expect = 0.83
Identities = 27/96 (28%), Positives = 40/96 (41%), Gaps = 2/96 (2%)
Frame = -3

Query: 351 MDARGFEPDWLTYKCLLAGYAVSGRTAQACQLFEQV-LQDGQHLHAETFKVMLKHLAGVN 175
M G EP L Y CLL G +G A +F+ + +D ++ +++K
Sbjct: 258 MRLAGVEPSRLIYNCLLDGLVNAGLLDTAVNVFDAMSTEDQVRPDVVSYNILIKGYCRAG 317

Query: 174 RAQEAFQYLQRMLELG-FDPDTWTYKSVNDGLRKEG 70
RA +A L M E PD TY ++ EG
Sbjct: 318 RAHDAMARLSEMQEQAKLTPDKVTYLTLMQCHYSEG 353



Score = 32.7 bits (73), Expect = 9.2
Identities = 19/86 (22%), Positives = 38/86 (44%), Gaps = 3/86 (3%)
Frame = -3

Query: 441 CSPNAIVYSTLIYGCGRAGNAQLAKSLMLEMDARGFEPDWLTYKCLLAGYAVSGRTAQAC 262
C Y+ LI G + + A M +G P ++ L +G +SG+ ++AC
Sbjct: 547 CDQTVYTYTILIDGLFKEHKNEEALKFWDAMIDKGITPTAAAFRTLASGLCLSGKFSRAC 606

Query: 261 QLFEQVLQDG---QHLHAETFKVMLK 193
++ +++ G + H + V+ K
Sbjct: 607 RILDELAPMGVIPETAHEDMINVLCK 632