BP912599
Clone id YMU001_000020_G06
Library
Length 452
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000020_G06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTCTGACATTCTTGAGCCATAAAGAAGAGCCATTCTGAAACTTCAACTGCACATCTCCCA
CTCCAAGTATGTCACAAACCTGCTCATTGCCAATTCTGACATAATCTTTAGTAGCCACAT
ATGACGTAAACCACTCTTTGTGCGGAGAAACATGTAAAGATGCGCCCTGAGTCGATAATC
CAATCACTCATAGCACGTCGCATCCTCTGCAGTCAAGAAAACAGAATCAAGATTGCTTGT
AAGGAAGATGTCACCACCTGCTATACCAGAATCACTGTCTGAACCAGATCCTGTGACATT
CACCTCTTCAATCTTCACTGAACTCTTCTTTTCATCTTGCTCAAAACTCTTTGTTTTGCC
TTTGTCTTGTTTCCACTTCGTACAGACTCGCTTCATGTAACCCTTCTTGCCACAATGGTA
GCATTCTATGTCATCCTTTGACTTCGAATCAC
■■Homology search results ■■ -
sp_hit_id P10978
Definition sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum
Align length 55
Score (bit) 38.5
E-value 0.014
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912599|Adiantum capillus-veneris mRNA, clone:
YMU001_000020_G06.
(452 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from tra... 39 0.014
sp|Q5VYS8|ZCHC6_HUMAN Zinc finger CCHC domain-containing protein... 35 0.20
sp|Q5BLK4|ZCHC6_MOUSE Zinc finger CCHC domain-containing protein... 34 0.25
sp|P60371|KR106_HUMAN Keratin-associated protein 10-6 OS=Homo sa... 34 0.25
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster G... 33 0.57
sp|P35955|GAG_VILVK Gag polyprotein OS=Maedi visna virus (strain... 32 0.97
sp|P23425|GAG_VILV2 Gag polyprotein OS=Maedi visna virus (strain... 32 0.97
sp|P23424|GAG_VILV1 Gag polyprotein OS=Maedi visna virus (strain... 32 0.97
sp|P03352|GAG_VILV Gag polyprotein OS=Maedi visna virus (strain ... 32 0.97
sp|P16900|GAG_OMVVS Gag polyprotein OS=Ovine maedi visna related... 32 0.97
sp|Q8VYP5|ZDH14_ARATH Probable S-acyltransferase At3g60800 OS=Ar... 32 1.7
sp|Q9CZA5|ZCH12_MOUSE Zinc finger CCHC domain-containing protein... 32 1.7
sp|Q6DJI9|ZCRB1_XENLA Zinc finger CCHC-type and RNA-binding moti... 31 2.2
sp|Q499V6|ZCRB1_RAT Zinc finger CCHC-type and RNA-binding motif-... 31 2.2
sp|Q56JZ7|ZCRB1_BOVIN Zinc finger CCHC-type and RNA-binding moti... 31 2.8
sp|Q3T033|MSPD3_BOVIN Motile sperm domain-containing protein 3 O... 31 2.8
sp|O16844|COST2_DROME Kinesin-like protein costal2 OS=Drosophila... 31 2.8
sp|Q9CZ96|ZCRB1_MOUSE Zinc finger CCHC-type and RNA-binding moti... 30 3.7
sp|Q5SP50|ZCRB1_DANRE Zinc finger CCHC-type and RNA-binding moti... 30 3.7
sp|A8YXG4|XPT_LACH4 Xanthine phosphoribosyltransferase OS=Lactob... 30 3.7
sp|Q5FMD9|XPT_LACAC Xanthine phosphoribosyltransferase OS=Lactob... 30 3.7
sp|P59355|SCX2_LEIQH Alpha-mammal toxin Lqh2 OS=Leiurus quinques... 30 3.7
sp|P01484|SCX2_ANDAU Alpha-mammal toxin AaH2 OS=Androctonus aust... 30 3.7
sp|P05892|GAG_SIVVT Gag polyprotein OS=Simian immunodeficiency v... 30 3.7
sp|P35962|GAG_HV1Y2 Gag polyprotein OS=Human immunodeficiency vi... 30 3.7
sp|P24736|GAG_HV1U4 Gag polyprotein OS=Human immunodeficiency vi... 30 3.7
sp|Q5HZA3|ZCH12_RAT Zinc finger CCHC domain-containing protein 1... 30 4.8
sp|P19560|POL_BIV29 Gag-Pol polyprotein OS=Bovine immunodeficien... 30 4.8
sp|P12493|GAG_HV1N5 Gag polyprotein OS=Human immunodeficiency vi... 30 4.8
sp|P05888|GAG_HV1MN Gag polyprotein OS=Human immunodeficiency vi... 30 4.8

>sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from
transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1
Length = 1328

Score = 38.5 bits (88), Expect = 0.014
Identities = 22/55 (40%), Positives = 32/55 (58%), Gaps = 1/55 (1%)
Frame = -2

Query: 163 ASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
AS H +P ++ F YVA V++GN I G+GD+ +K G +L LK+VR
Sbjct: 300 ASHHATPVRDLFCRYVAGDFGTVKMGNTSYSKIAGIGDICIKTNVGCTLVLKDVR 354



Score = 33.5 bits (75), Expect = 0.43
Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 1/52 (1%)
Frame = -3

Query: 447 SKSKDDIE-CYHCGKKGYMKRVCTKWKQDKGKTKSFEQDEKKSSVKIEEVNV 295
++SK + CY+C + G+ KR C ++ KG+T + D+ +++ NV
Sbjct: 223 NRSKSRVRNCYNCNQPGHFKRDCPNPRKGKGETSGQKNDDNTAAMVQNNDNV 274


>sp|Q5VYS8|ZCHC6_HUMAN Zinc finger CCHC domain-containing protein 6
OS=Homo sapiens GN=ZCCHC6 PE=1 SV=1
Length = 1495

Score = 34.7 bits (78), Expect = 0.20
Identities = 14/46 (30%), Positives = 25/46 (54%)
Frame = -3

Query: 450 DSKSKDDIECYHCGKKGYMKRVCTKWKQDKGKTKSFEQDEKKSSVK 313
D K + C+ CG++G++K+ C ++K G S + K+S K
Sbjct: 1444 DDKDLREKRCFICGREGHIKKECPQFKGSSGSLSSKYMTQGKASAK 1489


>sp|Q5BLK4|ZCHC6_MOUSE Zinc finger CCHC domain-containing protein 6
OS=Mus musculus GN=Zcchc6 PE=2 SV=2
Length = 1491

Score = 34.3 bits (77), Expect = 0.25
Identities = 13/46 (28%), Positives = 26/46 (56%)
Frame = -3

Query: 450 DSKSKDDIECYHCGKKGYMKRVCTKWKQDKGKTKSFEQDEKKSSVK 313
D + + C+ CG++G++K+ C ++K G S + ++SVK
Sbjct: 1440 DDRDSREKRCFICGREGHIKKECPQFKGSPGSLSSKYMTQGRASVK 1485


>sp|P60371|KR106_HUMAN Keratin-associated protein 10-6 OS=Homo
sapiens GN=KRTAP10-6 PE=2 SV=1
Length = 365

Score = 34.3 bits (77), Expect = 0.25
Identities = 34/141 (24%), Positives = 53/141 (37%), Gaps = 8/141 (5%)
Frame = +3

Query: 48 CTSPTPSMSQTCSLPILT*SL--VATYDVNHSLCGE--TCKDAP*VDNPITHSTSHPLQS 215
C + +P Q C +P+ + V T + S C + +C+ A +P H+ P+ S
Sbjct: 218 CCTSSPCQ-QACCVPVCCVPVCCVPTCSEDSSSCCQQSSCQPACCTSSPCQHACCVPVCS 276

Query: 216 RKQNQDCL*GRCHHLLYQNHCLNQIL*HSPLQSSLNSSFHLAQNSLFCLCLVSTSYRLAS 395
C C C SS++ H S C+ + S +S
Sbjct: 277 GASTSCCQQSSCQPACCTASCCRS-------SSSVSLLCHPVCKSTCCVPVPSCGASASS 329

Query: 396 CNPSCHNG----SILCHPLTS 446
C PSC S+LC P+ S
Sbjct: 330 CQPSCCRTASCVSLLCRPMCS 350


>sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster
GN=GIP PE=1 SV=3
Length = 1409

Score = 33.1 bits (74), Expect = 0.57
Identities = 17/56 (30%), Positives = 33/56 (58%), Gaps = 6/56 (10%)
Frame = -3

Query: 441 SKDDIECYHCGKKGYMKRVCTKWKQD-KGKTKSFEQDEKKS-----SVKIEEVNVT 292
SK ++C+HCG++G++K+ C +K+ K K E+ + + + ++EVN T
Sbjct: 226 SKYKVKCHHCGREGHIKKDCFHYKRILNNKNKENEKQVQTATSHGIAFMVKEVNNT 281


>sp|P35955|GAG_VILVK Gag polyprotein OS=Maedi visna virus (strain
KV1772) GN=gag PE=3 SV=1
Length = 442

Score = 32.3 bits (72), Expect = 0.97
Identities = 11/24 (45%), Positives = 18/24 (75%)
Frame = -3

Query: 438 KDDIECYHCGKKGYMKRVCTKWKQ 367
+ I C+HCGK+G+M++ C + KQ
Sbjct: 401 RQGIICHHCGKRGHMQKDCRQKKQ 424


>sp|P23425|GAG_VILV2 Gag polyprotein OS=Maedi visna virus (strain
1514 / clone LV1-1KS2) GN=gag PE=3 SV=1
Length = 442

Score = 32.3 bits (72), Expect = 0.97
Identities = 11/24 (45%), Positives = 18/24 (75%)
Frame = -3

Query: 438 KDDIECYHCGKKGYMKRVCTKWKQ 367
+ I C+HCGK+G+M++ C + KQ
Sbjct: 401 RQGIICHHCGKRGHMQKDCRQKKQ 424


>sp|P23424|GAG_VILV1 Gag polyprotein OS=Maedi visna virus (strain
1514 / clone LV1-1KS1) GN=gag PE=3 SV=1
Length = 442

Score = 32.3 bits (72), Expect = 0.97
Identities = 11/24 (45%), Positives = 18/24 (75%)
Frame = -3

Query: 438 KDDIECYHCGKKGYMKRVCTKWKQ 367
+ I C+HCGK+G+M++ C + KQ
Sbjct: 401 RQGIICHHCGKRGHMQKDCRQKKQ 424


>sp|P03352|GAG_VILV Gag polyprotein OS=Maedi visna virus (strain
1514) GN=gag PE=3 SV=1
Length = 442

Score = 32.3 bits (72), Expect = 0.97
Identities = 11/24 (45%), Positives = 18/24 (75%)
Frame = -3

Query: 438 KDDIECYHCGKKGYMKRVCTKWKQ 367
+ I C+HCGK+G+M++ C + KQ
Sbjct: 401 RQGIICHHCGKRGHMQKDCRQKKQ 424


>sp|P16900|GAG_OMVVS Gag polyprotein OS=Ovine maedi visna related
virus (strain South Africa) GN=gag PE=3 SV=1
Length = 446

Score = 32.3 bits (72), Expect = 0.97
Identities = 13/38 (34%), Positives = 24/38 (63%)
Frame = -3

Query: 438 KDDIECYHCGKKGYMKRVCTKWKQDKGKTKSFEQDEKK 325
+ I C+HCGK+G+M++ C +Q KG S + + ++
Sbjct: 400 RQGIICHHCGKRGHMQKDC---RQKKGNPTSQQGNSRR 434


tr_hit_id A5APH6
Definition tr|A5APH6|A5APH6_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 56
Score (bit) 43.5
E-value 5.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912599|Adiantum capillus-veneris mRNA, clone:
YMU001_000020_G06.
(452 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5APH6|A5APH6_VITVI Putative uncharacterized protein OS=Vitis... 44 5e-08
tr|A7PQ76|A7PQ76_VITVI Chromosome chr18 scaffold_24, whole genom... 43 3e-07
tr|A5ADV4|A5ADV4_VITVI Putative uncharacterized protein OS=Vitis... 43 3e-07
tr|A5CB53|A5CB53_VITVI Putative uncharacterized protein OS=Vitis... 43 6e-07
tr|A5B9T5|A5B9T5_VITVI Putative uncharacterized protein OS=Vitis... 55 2e-06
tr|A5C9D7|A5C9D7_VITVI Putative uncharacterized protein OS=Vitis... 54 5e-06
tr|A5B4R8|A5B4R8_VITVI Putative uncharacterized protein OS=Vitis... 54 5e-06
tr|A5BWL7|A5BWL7_VITVI Putative uncharacterized protein OS=Vitis... 43 1e-05
tr|A5BJP3|A5BJP3_VITVI Putative uncharacterized protein (Fragmen... 52 1e-05
tr|A5C2E5|A5C2E5_VITVI Putative uncharacterized protein OS=Vitis... 51 3e-05
tr|A5BVV6|A5BVV6_VITVI Putative uncharacterized protein (Fragmen... 51 3e-05
tr|A5BM67|A5BM67_VITVI Putative uncharacterized protein (Fragmen... 51 3e-05
tr|Q53QA4|Q53QA4_ORYSJ Retrotransposon protein, putative, Ty1-co... 51 3e-05
tr|Q2QQ81|Q2QQ81_ORYSJ Retrotransposon protein, putative, Ty1-co... 51 3e-05
tr|Q2QPE3|Q2QPE3_ORYSJ Retrotransposon protein, putative, Ty1-co... 51 3e-05
tr|Q0IN60|Q0IN60_ORYSJ Os12g0503600 protein OS=Oryza sativa subs... 51 3e-05
tr|Q0E1G5|Q0E1G5_ORYSJ Os02g0450400 protein OS=Oryza sativa subs... 51 3e-05
tr|Q01M93|Q01M93_ORYSA OSIGBa0146N20.7 protein OS=Oryza sativa G... 51 3e-05
tr|A5BBW7|A5BBW7_VITVI Putative uncharacterized protein OS=Vitis... 43 4e-05
tr|A5BM11|A5BM11_VITVI Putative uncharacterized protein OS=Vitis... 50 7e-05
tr|A5AJ06|A5AJ06_VITVI Putative uncharacterized protein OS=Vitis... 49 1e-04
tr|A5C761|A5C761_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|A5AJI7|A5AJI7_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|Q7XLX2|Q7XLX2_ORYSA OSJNBa0042I15.19 protein OS=Oryza sativa ... 48 2e-04
tr|Q75HA9|Q75HA9_ORYSJ Putative polyprotein (Retrotransposon pro... 48 2e-04
tr|Q2QUM8|Q2QUM8_ORYSJ Retrotransposon protein, putative, Ty1-co... 48 2e-04
tr|Q2QSQ2|Q2QSQ2_ORYSJ Retrotransposon protein, putative, Ty1-co... 48 2e-04
tr|A5AJD8|A5AJD8_VITVI Putative uncharacterized protein OS=Vitis... 48 2e-04
tr|Q5MG99|Q5MG99_IPOBA Hypothetical retrotransposon OS=Ipomoea b... 47 4e-04
tr|B8YLY6|B8YLY6_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 47 4e-04

>tr|A5APH6|A5APH6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018181 PE=4 SV=1
Length = 1069

Score = 43.5 bits (101), Expect(3) = 5e-08
Identities = 22/56 (39%), Positives = 31/56 (55%), Gaps = 1/56 (1%)
Frame = -2

Query: 166 GASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
GA H +PH+E +Y A V + N D++G+GDVQ+ NGS L+ VR
Sbjct: 291 GALFHTTPHREIIQNYAAGDFGKVYLANNSTLDVVGLGDVQISLXNGSVWLLEKVR 346



Score = 32.0 bits (71), Expect(3) = 5e-08
Identities = 18/50 (36%), Positives = 28/50 (56%)
Frame = -3

Query: 447 SKSKDDIECYHCGKKGYMKRVCTKWKQDKGKTKSFEQDEKKSSVKIEEVN 298
S+S ++C++CGK G+ KR C K K K K + ++V EEV+
Sbjct: 231 SRSGQQVQCWNCGKIGHFKRQC---KSPKKKNK-----DDYANVVTEEVH 272



Score = 24.3 bits (51), Expect(3) = 5e-08
Identities = 7/14 (50%), Positives = 11/14 (78%)
Frame = -1

Query: 197 RAMSDWIIDSGRIF 156
R + DW++DSG +F
Sbjct: 281 RPLDDWVLDSGALF 294


>tr|A7PQ76|A7PQ76_VITVI Chromosome chr18 scaffold_24, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021950001
PE=4 SV=1
Length = 301

Score = 43.1 bits (100), Expect(3) = 3e-07
Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
Frame = -2

Query: 166 GASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
GAS H +PH+E +YVA V + + D++G+GDV++ NGS L+ VR
Sbjct: 231 GASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 286



Score = 33.1 bits (74), Expect(3) = 3e-07
Identities = 15/49 (30%), Positives = 27/49 (55%)
Frame = -3

Query: 447 SKSKDDIECYHCGKKGYMKRVCTKWKQDKGKTKSFEQDEKKSSVKIEEV 301
S+S ++C++CGK G+ KR C K+ + ++ ++ IEEV
Sbjct: 171 SRSGQQVQCWNCGKTGHFKRQC--------KSPKKKNEDDSANAVIEEV 211



Score = 21.2 bits (43), Expect(3) = 3e-07
Identities = 6/12 (50%), Positives = 9/12 (75%)
Frame = -1

Query: 191 MSDWIIDSGRIF 156
+ DW++DSG F
Sbjct: 223 LDDWVLDSGASF 234


>tr|A5ADV4|A5ADV4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_028182 PE=4 SV=1
Length = 815

Score = 43.1 bits (100), Expect(3) = 3e-07
Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
Frame = -2

Query: 166 GASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
GAS H +PH+E +YVA V + + D++G+GDV++ NGS L+ VR
Sbjct: 291 GASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 346



Score = 32.7 bits (73), Expect(3) = 3e-07
Identities = 15/49 (30%), Positives = 27/49 (55%)
Frame = -3

Query: 447 SKSKDDIECYHCGKKGYMKRVCTKWKQDKGKTKSFEQDEKKSSVKIEEV 301
S+S ++C++CGK G+ KR C K+ + ++ ++V EEV
Sbjct: 231 SRSGQQVQCWNCGKTGHFKRQC--------KSPKKKNEDDSANVVTEEV 271



Score = 21.2 bits (43), Expect(3) = 3e-07
Identities = 6/12 (50%), Positives = 9/12 (75%)
Frame = -1

Query: 191 MSDWIIDSGRIF 156
+ DW++DSG F
Sbjct: 283 LDDWVLDSGASF 294


>tr|A5CB53|A5CB53_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_034155 PE=4 SV=1
Length = 405

Score = 43.1 bits (100), Expect(3) = 6e-07
Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
Frame = -2

Query: 166 GASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
GAS H +PH+E +YVA V + + D++G+GDV++ NGS L+ VR
Sbjct: 291 GASFHTTPHREIIQNYVAGDFGKVYLADGSALDVVGLGDVRISLPNGSVWLLEKVR 346



Score = 32.0 bits (71), Expect(3) = 6e-07
Identities = 17/47 (36%), Positives = 26/47 (55%)
Frame = -3

Query: 447 SKSKDDIECYHCGKKGYMKRVCTKWKQDKGKTKSFEQDEKKSSVKIE 307
S+S ++C++CGK G+ KR C K K K QD+ ++V E
Sbjct: 231 SRSGQQVQCWNCGKTGHFKRQC---KSPKKK----NQDDSANAVTEE 270



Score = 21.2 bits (43), Expect(3) = 6e-07
Identities = 6/12 (50%), Positives = 9/12 (75%)
Frame = -1

Query: 191 MSDWIIDSGRIF 156
+ DW++DSG F
Sbjct: 283 LDDWVLDSGASF 294


>tr|A5B9T5|A5B9T5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_030853 PE=4 SV=1
Length = 1017

Score = 54.7 bits (130), Expect = 2e-06
Identities = 26/56 (46%), Positives = 40/56 (71%), Gaps = 1/56 (1%)
Frame = -2

Query: 166 GASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
GAS+H +P K++FTSY + VR+GN+ + +G+GDV+L+ NG+ L LKNV+
Sbjct: 50 GASIHATPRKDFFTSYTFSDFGSVRMGNDGLAKAIGMGDVRLETSNGTMLTLKNVK 105


>tr|A5C9D7|A5C9D7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007304 PE=4 SV=1
Length = 1362

Score = 53.5 bits (127), Expect = 5e-06
Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 1/56 (1%)
Frame = -2

Query: 166 GASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
GAS+H +P K++FTSY + VR+GN+ +G+GDV+L+ NG+ L LKNV+
Sbjct: 276 GASIHATPQKDFFTSYTSGDFGSVRMGNDGSAKAIGMGDVRLETSNGTMLTLKNVK 331



Score = 33.9 bits (76), Expect = 4.2
Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 6/44 (13%)
Frame = -3

Query: 447 SKSKDD----IECYHCGKKGYMKRVCTKWKQD--KGKTKSFEQD 334
SKSK + +EC++C KG++K+ C + K+D +GK K + D
Sbjct: 195 SKSKTNKFANVECHYCHLKGHIKKYCRQLKRDMKQGKVKEKKND 238


>tr|A5B4R8|A5B4R8_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_018405 PE=4 SV=1
Length = 1302

Score = 53.5 bits (127), Expect = 5e-06
Identities = 26/56 (46%), Positives = 39/56 (69%), Gaps = 1/56 (1%)
Frame = -2

Query: 166 GASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
GAS+H +P K++FTSY + VR+GN+ +G+GDV+L+ NG+ L LKNV+
Sbjct: 163 GASIHATPRKDFFTSYTSGDFGSVRMGNDGSAKAIGMGDVRLETSNGTMLTLKNVK 218



Score = 33.9 bits (76), Expect = 4.2
Identities = 17/44 (38%), Positives = 28/44 (63%), Gaps = 6/44 (13%)
Frame = -3

Query: 447 SKSKDD----IECYHCGKKGYMKRVCTKWKQD--KGKTKSFEQD 334
SKSK + +EC++C KG++K+ C + K+D +GK K + D
Sbjct: 82 SKSKTNKXANVECHYCHLKGHIKKYCRQLKRDMKQGKVKEKKND 125


>tr|A5BWL7|A5BWL7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_038864 PE=4 SV=1
Length = 1172

Score = 42.7 bits (99), Expect(3) = 1e-05
Identities = 22/56 (39%), Positives = 33/56 (58%), Gaps = 1/56 (1%)
Frame = -2

Query: 166 GASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
GAS H +PH+E +YVA V + + D++G+GDV++ NGS L+ VR
Sbjct: 223 GASFHTTPHREIIQNYVAGDFGKVYLADGSTLDVVGLGDVRITLPNGSIWLLEKVR 278



Score = 27.7 bits (60), Expect(3) = 1e-05
Identities = 13/49 (26%), Positives = 26/49 (53%)
Frame = -3

Query: 447 SKSKDDIECYHCGKKGYMKRVCTKWKQDKGKTKSFEQDEKKSSVKIEEV 301
S+S ++C++ GK G+ KR C K+ + ++ ++ IEE+
Sbjct: 163 SRSGQQVQCWNYGKTGHFKRQC--------KSPKKKNEDDSANAVIEEL 203



Score = 21.2 bits (43), Expect(3) = 1e-05
Identities = 6/12 (50%), Positives = 9/12 (75%)
Frame = -1

Query: 191 MSDWIIDSGRIF 156
+ DW++DSG F
Sbjct: 215 LDDWVLDSGASF 226


>tr|A5BJP3|A5BJP3_VITVI Putative uncharacterized protein (Fragment)
OS=Vitis vinifera GN=VITISV_001876 PE=4 SV=1
Length = 1392

Score = 52.0 bits (123), Expect = 1e-05
Identities = 26/56 (46%), Positives = 38/56 (67%), Gaps = 1/56 (1%)
Frame = -2

Query: 166 GASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
GAS+H +P K++FTSY + VR+GN+ +G+GDV L+ NG+ L LKNV+
Sbjct: 166 GASIHATPRKDFFTSYTSGDFGSVRMGNDGSAKAIGMGDVCLETSNGTMLTLKNVK 221


>tr|A5C2E5|A5C2E5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029099 PE=4 SV=1
Length = 649

Score = 51.2 bits (121), Expect = 3e-05
Identities = 26/56 (46%), Positives = 37/56 (66%), Gaps = 1/56 (1%)
Frame = -2

Query: 166 GASLHVSPHKEWFTSYVATK-DYVRIGNEQVCDILGVGDVQLKFQNGSSLWLKNVR 2
GAS+H +P K++FTSY + VR+GN+ +G+GDV L+ NG L LKNV+
Sbjct: 252 GASIHATPRKDFFTSYTSGDFGSVRMGNDGSAKAIGMGDVHLETSNGIVLILKNVK 307