BP912628
Clone id YMU001_000021_A12
Library
Length 508
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000021_A12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAGCTGCGATAATGAGCGCTGGAGGTGGATTCGGTGGAGGAAGAAGCCAGTACCACTTGA
GGCAGACGGGTGTTTTTCTTGATCTACATTTTATAAACAAGCCTGAGCTTTTTGTGAAGG
CATTCGAGCCTCCTGCCAAATTTGATGGAGAGGGAAATCTTATACACGAAGACACGAGAG
AACGAATCAAAGCATTTGCTGATAGCTTTGCAGAAATGGACTCAGAGGCTTCAAGGGGTG
TGTGAATGAAGGTTTTTCACCGTTATATCATATCTTGGGTAAAGAGCATGTCATGGGGGA
ATAAAACTCGCGTGGTATTGTGGATTGCTGGGCATTTTGAGGCATGTTAGGGTATTCAAA
TTCTTTTGTCTGTAGGGAGCTTTGTTTATTAAGAATTGTCTGGGGTGGCTCATGCAACGC
TAGATCATGAATACTCGATGCAGATGGGATATACCAAGTTACTTCCTAAATGAAGTTCTC
TGTATTATAATTTTTCTCATGTATGCCA
■■Homology search results ■■ -
sp_hit_id Q941Z0
Definition sp|Q941Z0|NQR1_ORYSJ Probable NADPH:quinone oxidoreductase 1 OS=Oryza sativa subsp. japonica
Align length 63
Score (bit) 89.0
E-value 1.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912628|Adiantum capillus-veneris mRNA, clone:
YMU001_000021_A12.
(508 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q941Z0|NQR1_ORYSJ Probable NADPH:quinone oxidoreductase 1 OS=... 89 1e-17
sp|Q9LK88|NQR_ARATH NADPH:quinone oxidoreductase OS=Arabidopsis ... 87 6e-17
sp|Q941Y8|NQR2_ORYSJ Probable NADPH:quinone oxidoreductase 2 OS=... 83 6e-16
sp|Q8H9D2|NQR_SOLTU NAD(P)H:quinone oxidoreductase OS=Solanum tu... 82 1e-15
sp|P0AGE8|YIEF_SHIFL Uncharacterized protein yieF OS=Shigella fl... 34 0.34
sp|P0AGE6|YIEF_ECOLI Uncharacterized protein yieF OS=Escherichia... 34 0.34
sp|P0AGE7|YIEF_ECO57 Uncharacterized protein yieF OS=Escherichia... 34 0.34
sp|Q2YV55|Y162_STAAB Uncharacterized sensor-like histidine kinas... 32 1.3
sp|Q01443|SSP2_PLAYO Sporozoite surface protein 2 OS=Plasmodium ... 30 5.0
sp|Q99WZ9|Y224_STAAM Uncharacterized sensor-like histidine kinas... 30 6.5
sp|Q2FK46|Y218_STAA3 Uncharacterized sensor-like histidine kinas... 30 6.5
sp|Q7A7X8|Y216_STAAN Uncharacterized sensor-like histidine kinas... 30 6.5
sp|Q6GK92|Y215_STAAR Uncharacterized sensor-like histidine kinas... 30 6.5
sp|Q5HJF6|Y202_STAAC Uncharacterized sensor-like histidine kinas... 30 6.5
sp|Q8NYJ8|Y199_STAAW Uncharacterized sensor-like histidine kinas... 30 6.5
sp|Q6GCQ2|Y199_STAAS Uncharacterized sensor-like histidine kinas... 30 6.5
sp|Q2G1E0|Y185_STAA8 Uncharacterized sensor-like histidine kinas... 30 6.5
sp|B2CW77|KILIN_HUMAN Killin OS=Homo sapiens PE=1 SV=1 30 8.6
sp|Q553R3|IF4G_DICDI Eukaryotic translation initiation factor 4 ... 30 8.6
sp|A1L131|CUED2_RAT CUE domain-containing protein 2 OS=Rattus no... 30 8.6

>sp|Q941Z0|NQR1_ORYSJ Probable NADPH:quinone oxidoreductase 1
OS=Oryza sativa subsp. japonica GN=Os01g0953600 PE=2
SV=1
Length = 197

Score = 89.0 bits (219), Expect = 1e-17
Identities = 45/63 (71%), Positives = 47/63 (74%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+SA RSQYHLRQ GVFLDLHFINKPEL VKAFE P KFD +GNLI RE
Sbjct: 118 AAIVSAGGGFGGGRSQYHLRQVGVFLDLHFINKPELAVKAFEQPPKFDSDGNLIDAQIRE 177

Query: 183 RIK 191
RIK
Sbjct: 178 RIK 180


>sp|Q9LK88|NQR_ARATH NADPH:quinone oxidoreductase OS=Arabidopsis
thaliana GN=NQR PE=1 SV=1
Length = 196

Score = 86.7 bits (213), Expect = 6e-17
Identities = 41/63 (65%), Positives = 47/63 (74%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+S RSQYHLRQ GVFLDLHFINKPE + AF+PP KFD EGNL+ E T+E
Sbjct: 118 AAIISTGGGFGGGRSQYHLRQIGVFLDLHFINKPEFTLNAFQPPQKFDAEGNLVDEVTKE 177

Query: 183 RIK 191
R+K
Sbjct: 178 RLK 180


>sp|Q941Y8|NQR2_ORYSJ Probable NADPH:quinone oxidoreductase 2
OS=Oryza sativa subsp. japonica GN=Os01g0954000 PE=2
SV=1
Length = 203

Score = 83.2 bits (204), Expect = 6e-16
Identities = 37/63 (58%), Positives = 47/63 (74%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+SA RS YH+RQ GVFLD+HFINKPE+F+KA +PP KFD +GNLI + +E
Sbjct: 117 AAIVSASGGSGGSRSMYHIRQVGVFLDIHFINKPEVFIKAHQPPKKFDSDGNLIDPEIKE 176

Query: 183 RIK 191
+K
Sbjct: 177 ELK 179


>sp|Q8H9D2|NQR_SOLTU NAD(P)H:quinone oxidoreductase OS=Solanum
tuberosum PE=2 SV=1
Length = 194

Score = 82.0 bits (201), Expect = 1e-15
Identities = 38/64 (59%), Positives = 48/64 (75%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AA++SA RSQYHLRQ GVFLDLHFINKPE F+ AF+ P KFD +G L E+T++
Sbjct: 114 AAMVSAGGGFGGGRSQYHLRQIGVFLDLHFINKPEFFLNAFQQPPKFDSDGVLTDEETKQ 173

Query: 183 RIKA 194
R++A
Sbjct: 174 RLRA 177


>sp|P0AGE8|YIEF_SHIFL Uncharacterized protein yieF OS=Shigella
flexneri GN=yieF PE=3 SV=1
Length = 188

Score = 34.3 bits (77), Expect = 0.34
Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
Frame = +3

Query: 42 RSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGE-GNLIHEDTRERIKAFADSFAE 215
R QYHLRQ VFLD +NKPE + K D + G +I + T + + +F E
Sbjct: 125 RCQYHLRQILVFLDAMVMNKPEFMGGVIQ--NKVDPQTGEVIDQGTLDHLTGQLTAFGE 181


>sp|P0AGE6|YIEF_ECOLI Uncharacterized protein yieF OS=Escherichia
coli (strain K12) GN=yieF PE=3 SV=1
Length = 188

Score = 34.3 bits (77), Expect = 0.34
Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
Frame = +3

Query: 42 RSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGE-GNLIHEDTRERIKAFADSFAE 215
R QYHLRQ VFLD +NKPE + K D + G +I + T + + +F E
Sbjct: 125 RCQYHLRQILVFLDAMVMNKPEFMGGVIQ--NKVDPQTGEVIDQGTLDHLTGQLTAFGE 181


>sp|P0AGE7|YIEF_ECO57 Uncharacterized protein yieF OS=Escherichia
coli O157:H7 GN=yieF PE=3 SV=1
Length = 188

Score = 34.3 bits (77), Expect = 0.34
Identities = 22/59 (37%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
Frame = +3

Query: 42 RSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGE-GNLIHEDTRERIKAFADSFAE 215
R QYHLRQ VFLD +NKPE + K D + G +I + T + + +F E
Sbjct: 125 RCQYHLRQILVFLDAMVMNKPEFMGGVIQ--NKVDPQTGEVIDQGTLDHLTGQLTAFGE 181


>sp|Q2YV55|Y162_STAAB Uncharacterized sensor-like histidine kinase
SAB0162c OS=Staphylococcus aureus (strain bovine RF122 /
ET3-1) GN=SAB0162c PE=3 SV=1
Length = 518

Score = 32.3 bits (72), Expect = 1.3
Identities = 21/58 (36%), Positives = 31/58 (53%)
Frame = -3

Query: 503 YMRKIIIQRTSFRK*LGISHLHRVFMI*RCMSHPRQFLINKAPYRQKNLNTLTCLKMP 330
Y+R+ + K LG++HLH MI + SH R + +K +NL TL C K+P
Sbjct: 459 YVRQSLNNDVFDTKHLGLNHLHNKAMI-QYGSHARLHIFSK-----RNLGTLICYKIP 510


>sp|Q01443|SSP2_PLAYO Sporozoite surface protein 2 OS=Plasmodium
yoelii yoelii GN=SSP2 PE=1 SV=2
Length = 827

Score = 30.4 bits (67), Expect = 5.0
Identities = 19/63 (30%), Positives = 24/63 (38%)
Frame = -2

Query: 405 PQTILNKQSSLQTKEFEYPNMPQNAQQSTIPREFYSPMTCSLPKI*YNGEKPSFTHPLKP 226
P N L E PN P N + + P E +P S P N E+P+ P P
Sbjct: 521 PNEPSNPNEPLNPNEPSNPNEPSNPNEPSNPEEPSNPKEPSNPNEPSNPEEPNPEEPSNP 580

Query: 225 LSP 217
P
Sbjct: 581 KEP 583


>sp|Q99WZ9|Y224_STAAM Uncharacterized sensor-like histidine kinase
SAV0224 OS=Staphylococcus aureus (strain Mu50 / ATCC
700699) GN=SAV0224 PE=3 SV=1
Length = 518

Score = 30.0 bits (66), Expect = 6.5
Identities = 20/58 (34%), Positives = 30/58 (51%)
Frame = -3

Query: 503 YMRKIIIQRTSFRK*LGISHLHRVFMI*RCMSHPRQFLINKAPYRQKNLNTLTCLKMP 330
Y+R+ + K LG++HLH MI + SH R + +K +N TL C K+P
Sbjct: 459 YVRQSLNNDVFDTKHLGLNHLHNKAMI-QYGSHARLHIFSK-----RNQGTLICYKIP 510


tr_hit_id A7Q5E8
Definition tr|A7Q5E8|A7Q5E8_VITVI Chromosome undetermined scaffold_53, whole genome shotgun sequence OS=Vitis vinifera
Align length 63
Score (bit) 95.5
E-value 1.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912628|Adiantum capillus-veneris mRNA, clone:
YMU001_000021_A12.
(508 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7Q5E8|A7Q5E8_VITVI Chromosome undetermined scaffold_53, whol... 96 1e-18
tr|Q0JFY5|Q0JFY5_ORYSJ Os01g0953600 protein (Putative uncharacte... 89 1e-16
tr|A5AS03|A5AS03_VITVI Putative uncharacterized protein OS=Vitis... 89 1e-16
tr|A2WZ68|A2WZ68_ORYSI Putative uncharacterized protein OS=Oryza... 89 1e-16
tr|A7Q5F1|A7Q5F1_VITVI Chromosome undetermined scaffold_53, whol... 88 2e-16
tr|Q2HIK0|Q2HIK0_ARATH At3g27890 OS=Arabidopsis thaliana PE=2 SV=1 87 6e-16
tr|B6T653|B6T653_MAIZE NADPH quinone oxidoreductase 1 OS=Zea may... 86 1e-15
tr|B4FWN1|B4FWN1_MAIZE Putative uncharacterized protein OS=Zea m... 85 2e-15
tr|B6UDE7|B6UDE7_MAIZE NADPH quinone oxidoreductase 1 OS=Zea may... 84 3e-15
tr|B4FVE1|B4FVE1_MAIZE Putative uncharacterized protein OS=Zea m... 84 3e-15
tr|B4FV07|B4FV07_MAIZE Putative uncharacterized protein OS=Zea m... 84 3e-15
tr|B6TL26|B6TL26_MAIZE NADPH quinone oxidoreductase 2 OS=Zea may... 84 5e-15
tr|Q0JFY4|Q0JFY4_ORYSJ cDNA clone:001-106-E03, full insert seque... 83 7e-15
tr|A2WZ70|A2WZ70_ORYSI Putative uncharacterized protein OS=Oryza... 83 7e-15
tr|B7FMX0|B7FMX0_MEDTR Putative uncharacterized protein OS=Medic... 82 1e-14
tr|A9P8U5|A9P8U5_POPTR Putative uncharacterized protein OS=Popul... 80 6e-14
tr|A5BJ84|A5BJ84_VITVI Putative uncharacterized protein OS=Vitis... 60 5e-08
tr|B3PKG2|B3PKG2_CELJU NAD(P)H:quinone oxidoreductase OS=Cellvib... 59 1e-07
tr|Q7P0N6|Q7P0N6_CHRVO Probable NADPH:quinone oxidoreductase OS=... 56 9e-07
tr|Q47CA4|Q47CA4_DECAR NAD(P)H dehydrogenase (Quinone):NADPH-dep... 55 1e-06
tr|B4X2C4|B4X2C4_9GAMM NADPH-dependent FMN reductase, putative O... 55 1e-06
tr|A6GUM8|A6GUM8_9BURK NAD(P)H dehydrogenase (Quinone):NADPH-dep... 51 3e-05
tr|Q9I4D4|Q9I4D4_PSEAE Putative uncharacterized protein OS=Pseud... 50 5e-05
tr|Q02J40|Q02J40_PSEAB Putative oxidoreductase OS=Pseudomonas ae... 50 5e-05
tr|A9AKT6|A9AKT6_BURM1 NADPH-dependent FMN reductase OS=Burkhold... 50 5e-05
tr|A6V8Z3|A6V8Z3_PSEA7 Putative uncharacterized protein OS=Pseud... 50 5e-05
tr|B7UWX2|B7UWX2_PSEAE Putative oxidoreductase OS=Pseudomonas ae... 50 5e-05
tr|A3L9M4|A3L9M4_PSEAE Putative uncharacterized protein OS=Pseud... 50 5e-05
tr|A3KRE8|A3KRE8_PSEAE Putative uncharacterized protein OS=Pseud... 50 5e-05
tr|Q63HS4|Q63HS4_BURPS Putative uncharacterized protein OS=Burkh... 50 6e-05

>tr|A7Q5E8|A7Q5E8_VITVI Chromosome undetermined scaffold_53, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00030910001 PE=4 SV=1
Length = 196

Score = 95.5 bits (236), Expect = 1e-18
Identities = 45/63 (71%), Positives = 50/63 (79%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+S RSQYHLRQ GV+LDLHFINKPE F+ AF+PPAKFDGEGNLI ED +E
Sbjct: 118 AAIISTGGGFGGGRSQYHLRQIGVYLDLHFINKPEFFLNAFQPPAKFDGEGNLIDEDAKE 177

Query: 183 RIK 191
RIK
Sbjct: 178 RIK 180


>tr|Q0JFY5|Q0JFY5_ORYSJ Os01g0953600 protein (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=Os01g0953600 PE=4 SV=1
Length = 197

Score = 89.0 bits (219), Expect = 1e-16
Identities = 45/63 (71%), Positives = 47/63 (74%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+SA RSQYHLRQ GVFLDLHFINKPEL VKAFE P KFD +GNLI RE
Sbjct: 118 AAIVSAGGGFGGGRSQYHLRQVGVFLDLHFINKPELAVKAFEQPPKFDSDGNLIDAQIRE 177

Query: 183 RIK 191
RIK
Sbjct: 178 RIK 180


>tr|A5AS03|A5AS03_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_012303 PE=4 SV=1
Length = 196

Score = 89.0 bits (219), Expect = 1e-16
Identities = 42/63 (66%), Positives = 48/63 (76%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+S SQYHLRQ GV+LDLHFINKPE F+ AF+PPAKFD EGNLI ED ++
Sbjct: 118 AAIISTGGGFGGGLSQYHLRQIGVYLDLHFINKPEFFLNAFQPPAKFDAEGNLIDEDAKK 177

Query: 183 RIK 191
RIK
Sbjct: 178 RIK 180


>tr|A2WZ68|A2WZ68_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05238 PE=4 SV=1
Length = 197

Score = 89.0 bits (219), Expect = 1e-16
Identities = 45/63 (71%), Positives = 47/63 (74%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+SA RSQYHLRQ GVFLDLHFINKPEL VKAFE P KFD +GNLI RE
Sbjct: 118 AAIVSAGGGFGGGRSQYHLRQVGVFLDLHFINKPELAVKAFEQPPKFDSDGNLIDAQIRE 177

Query: 183 RIK 191
RIK
Sbjct: 178 RIK 180


>tr|A7Q5F1|A7Q5F1_VITVI Chromosome undetermined scaffold_53, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00030913001 PE=4 SV=1
Length = 196

Score = 88.2 bits (217), Expect = 2e-16
Identities = 41/63 (65%), Positives = 48/63 (76%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+S SQYHLRQ GV++DLHFINKPE F+ AF+PPAKFD EGNLI ED ++
Sbjct: 118 AAIISTGGGFGGGLSQYHLRQIGVYIDLHFINKPEFFLNAFQPPAKFDAEGNLIDEDAKK 177

Query: 183 RIK 191
RIK
Sbjct: 178 RIK 180


>tr|Q2HIK0|Q2HIK0_ARATH At3g27890 OS=Arabidopsis thaliana PE=2 SV=1
Length = 196

Score = 86.7 bits (213), Expect = 6e-16
Identities = 41/63 (65%), Positives = 47/63 (74%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+S RSQYHLRQ GVFLDLHFINKPE + AF+PP KFD EGNL+ E T+E
Sbjct: 118 AAIISTGGGFGGGRSQYHLRQIGVFLDLHFINKPEFTLNAFQPPQKFDAEGNLVDEVTKE 177

Query: 183 RIK 191
R+K
Sbjct: 178 RLK 180


>tr|B6T653|B6T653_MAIZE NADPH quinone oxidoreductase 1 OS=Zea mays
PE=2 SV=1
Length = 202

Score = 85.9 bits (211), Expect = 1e-15
Identities = 41/63 (65%), Positives = 48/63 (76%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+SA RSQYHLRQ GVFLDLHFINKPEL V+AF+ P KFD +GNL+ + RE
Sbjct: 123 AAIVSAGGGFGGGRSQYHLRQVGVFLDLHFINKPELCVQAFQQPPKFDSDGNLVDAEIRE 182

Query: 183 RIK 191
R+K
Sbjct: 183 RLK 185


>tr|B4FWN1|B4FWN1_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 210

Score = 84.7 bits (208), Expect = 2e-15
Identities = 36/62 (58%), Positives = 49/62 (79%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAKFDGEGNLIHEDTRE 182
AAI+SA RSQYH+RQ GVFLDLHF+NKPE+F +A +PP+KFD +GNL+ DT++
Sbjct: 123 AAILSASGGSGGSRSQYHVRQVGVFLDLHFVNKPEVFTRAHQPPSKFDDDGNLVDPDTKD 182

Query: 183 RI 188
++
Sbjct: 183 QV 184


>tr|B6UDE7|B6UDE7_MAIZE NADPH quinone oxidoreductase 1 OS=Zea mays
PE=2 SV=1
Length = 200

Score = 84.3 bits (207), Expect = 3e-15
Identities = 44/64 (68%), Positives = 48/64 (75%), Gaps = 1/64 (1%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAK-FDGEGNLIHEDTR 179
AAI+SA RS YHLRQ GVFLD+HFINKPELFV AF PAK FD +GNLI DTR
Sbjct: 119 AAIVSAGGNFGGGRSSYHLRQVGVFLDIHFINKPELFVFAFFEPAKFFDSDGNLIDADTR 178

Query: 180 ERIK 191
ER+K
Sbjct: 179 ERLK 182


>tr|B4FVE1|B4FVE1_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 200

Score = 84.3 bits (207), Expect = 3e-15
Identities = 44/64 (68%), Positives = 48/64 (75%), Gaps = 1/64 (1%)
Frame = +3

Query: 3 AAIMSAXXXXXXXRSQYHLRQTGVFLDLHFINKPELFVKAFEPPAK-FDGEGNLIHEDTR 179
AAI+SA RS YHLRQ GVFLD+HFINKPELFV AF PAK FD +GNLI DTR
Sbjct: 119 AAIVSAGGNFGGGRSSYHLRQVGVFLDIHFINKPELFVFAFFEPAKFFDSDGNLIDADTR 178

Query: 180 ERIK 191
ER+K
Sbjct: 179 ERLK 182