BP912630 [AcEST]

BP912630
Clone id	YMU001_000021_B02
Library	YMU01
Length	332
Definition	Adiantum capillus-veneris mRNA. clone: YMU001_000021_B02.
Accession	BP912630
Tissue type	prothallium
Developmental stage	-
Contig ID	CL1306Contig1
Sequence	CTGCAATTTCACCTCTTCATCACACAGCCTCTTCCCGCGGCCAGTCCCAAAGTTTCCAAG ACTCAACTTTACGAACTTCGTTGCTCTCATTCTCTCTCCAGGCGCAATTTTTCATTAACA AGCACCACTCCCCCACGATCGACGCCTTCAGCACCAGGTTTCCTTCTCCCAGTCGGTGTA GCTCACTCACGGAAAGCAGCAGGAGGTAGCTCATTCTTCTGTTAATTAAACCCTCTTTCT TTAATGCTTTCTCTCTGAGTGGCGCCTCCATCATACTTCAAATCCTGCATATTTTCTTCA CCGCTTTAGCACCAATTCTCCTCCACTTCGTC
■■Homology search results ■■	-
Swiss-Prot (release 56.9)	Link to BlastX Result : Swiss-Prot
sp_hit_id	-
Definition	No hits.
Align length	-
Score (bit)	-
E-value	-
Report	BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BP912630\|Adiantum capillus-veneris mRNA, clone: YMU001_000021_B02. (332 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching..................................................done *** No hits found ****
TrEMBL (release 39.9)	Link to BlastX Result : TrEMBL
tr_hit_id	A1BAH8
Definition	tr\|A1BAH8\|A1BAH8_PARDP RNA binding S1 domain protein OS=Paracoccus denitrificans (strain Pd 1222)
Align length	46
Score (bit)	32.7
E-value	9.4
Report	BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BP912630\|Adiantum capillus-veneris mRNA, clone: YMU001_000021_B02. (332 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tr\|A1BAH8\|A1BAH8_PARDP RNA binding S1 domain protein OS=Paracocc... 33 9.4 >tr\|A1BAH8\|A1BAH8_PARDP RNA binding S1 domain protein OS=Paracoccus denitrificans (strain Pd 1222) GN=Pden_4458 PE=4 SV=1 Length = 770 Score = 32.7 bits (73), Expect = 9.4 Identities = 18/46 (39%), Positives = 27/46 (58%) Frame = -1 Query: 281 LKYDGGATQRESIKERGFNQKNELPPAAFREATPTGRRKPGAEG 144 ++ DGGA+ R++ KERG + PA + A P G+ +PGA G Sbjct: 720 MRKDGGASARDAQKERG-----PKAQPARGPKSAAPAGKEQPGALG 760