BP912672
Clone id YMU001_000021_E11
Library
Length 535
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000021_E11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCGAAGGGAATAAACCAAGTGTTAGTATCCAAAGAGCACATCAAAGTCAAAGACCCAGTT
TGGATACATGAAGCATGGGTTCAACCACAACAACAAAAGGTGACAGGTGGGTAGCATCAA
ATAAGTCAATCACTGCTCAGGGATACTTCCAAGGAAACGCTAATGTTTGGGCCAAAAAGC
CTAAATTAATAGCCTAGACCTACCCATCTCAACCAACGTGTTCTACAAAGAACAAGATCC
GCTATAAACACAAGACAAACAACTCAAATTGGAGAAAGAAAAACCACAAAAGGCAAAAGA
AAAGACCTTCCAAGCAAAAAATGCGACAAGTTTAAGTACCAAAGTTAGACGCTAGTCAAG
TTACCCAAGAAAAACATGTGAAACAACGGATGATTCCAGTGAAGCTACTCAAATCACAAG
GATTTTATGAAGGTAACACTCAAATATGGTTACCAAAAGTTGTAGCTCAGTCTGGAACAA
CCAAGAAAAATCATGTACACAAGTTTCTGTCCTAAGGCAGGCAATAATAACCAAC
■■Homology search results ■■ -
sp_hit_id Q54I66
Definition sp|Q54I66|Y9399_DICDI Putative uncharacterized protein DDB_G0288973 OS=Dictyostelium discoideum
Align length 83
Score (bit) 32.7
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912672|Adiantum capillus-veneris mRNA, clone:
YMU001_000021_E11.
(535 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54I66|Y9399_DICDI Putative uncharacterized protein DDB_G0288... 33 1.1
sp|Q54LU8|Y8646_DICDI Probable serine/threonine-protein kinase D... 33 1.1
sp|O75420|PERQ1_HUMAN PERQ amino acid-rich with GYF domain-conta... 33 1.1
sp|Q6IMN6|CAPR2_HUMAN Caprin-2 OS=Homo sapiens GN=CAPRIN2 PE=1 SV=1 32 1.5
sp|Q9PQW0|Y183_UREPA Uncharacterized protein UU183 OS=Ureaplasma... 32 2.5
sp|Q5VWG9|TAF3_HUMAN Transcription initiation factor TFIID subun... 31 3.3
sp|A7UXD4|CHL1_NEUCR ATP-dependent RNA helicase chl-1 OS=Neurosp... 31 3.3
sp|P21525|FOSL_DROME Transcription factor kayak OS=Drosophila me... 31 4.3
sp|P21401|VGLM_RVFVZ Envelope glycoprotein OS=Rift valley fever ... 31 4.3
sp|Q3KRF1|SP110_RAT Sp110 nuclear body protein OS=Rattus norvegi... 30 5.6
sp|O14340|YB35_SCHPO Oxysterol-binding protein homolog C2F12.05c... 30 7.3
sp|P0C5Y8|ALS2_RAT Alsin OS=Rattus norvegicus GN=Als2 PE=2 SV=1 30 7.3
sp|Q8D385|ZNUC_WIGBR Zinc import ATP-binding protein znuC OS=Wig... 30 9.5
sp|Q13823|NOG2_HUMAN Nucleolar GTP-binding protein 2 OS=Homo sap... 30 9.5

>sp|Q54I66|Y9399_DICDI Putative uncharacterized protein DDB_G0288973
OS=Dictyostelium discoideum GN=DDB_G0288973 PE=4 SV=1
Length = 461

Score = 32.7 bits (73), Expect = 1.1
Identities = 20/83 (24%), Positives = 34/83 (40%), Gaps = 5/83 (6%)
Frame = +3

Query: 204 PSQPTCSTKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKH-- 377
PSQPT +N+I + NN+N N+ + + + +T +H
Sbjct: 369 PSQPTSPPQNEINNNNNNNNNNNNNNNNNNNNNNNNNNNNNN------NNNSITSIRHLV 422

Query: 378 ---VKQRMIPVKLLKSQGFYEGN 437
+ QR+ K LK+ +GN
Sbjct: 423 LNSINQRIFATKTLKTNEISKGN 445


>sp|Q54LU8|Y8646_DICDI Probable serine/threonine-protein kinase
DDB_G0286465 OS=Dictyostelium discoideum GN=DDB_G0286465
PE=3 SV=1
Length = 1221

Score = 32.7 bits (73), Expect = 1.1
Identities = 26/121 (21%), Positives = 56/121 (46%), Gaps = 4/121 (3%)
Frame = +3

Query: 150 QGNANVWAKKPKLIA*TYPSQPTCSTKNKIRYKHKTNNS-NWRKKNHKRQKKRPSKQKM- 323
QG + + + ++ +P + CS N + K K N K+N +++KK+ KQK
Sbjct: 1071 QGVSRIKSTDYPALSDLFPKKKRCSENNFVFEKEKKQEKENKEKENKEKEKKQLEKQKQL 1130

Query: 324 --RQV*VPKLDASQVTQEKHVKQRMIPVKLLKSQGFYEGNTQIWLPKVVAQSGTTKKNHV 497
++ +L+ ++ +E+ K + K L+++ + + L K + +KKN
Sbjct: 1131 EREKLEKDRLEKDRLEKEQQEKDCLEREKFLENERLEKEQEREKLEKEIKILVVSKKNRT 1190

Query: 498 H 500
+
Sbjct: 1191 N 1191


>sp|O75420|PERQ1_HUMAN PERQ amino acid-rich with GYF
domain-containing protein 1 OS=Homo sapiens GN=GIGYF1
PE=1 SV=2
Length = 1035

Score = 32.7 bits (73), Expect = 1.1
Identities = 15/64 (23%), Positives = 36/64 (56%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIPVKL 407
+ ++ + K +++ KR++++ +QK RQ + ++ + KHV+Q+ + +KL
Sbjct: 688 RREVELRAKREEEERKRREEKRRQQQQEEQKRRQ------EEEELFRRKHVRQQELLLKL 741

Query: 408 LKSQ 419
L+ Q
Sbjct: 742 LQQQ 745


>sp|Q6IMN6|CAPR2_HUMAN Caprin-2 OS=Homo sapiens GN=CAPRIN2 PE=1 SV=1
Length = 1127

Score = 32.3 bits (72), Expect = 1.5
Identities = 20/72 (27%), Positives = 37/72 (51%), Gaps = 2/72 (2%)
Frame = +3

Query: 276 KKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQ--RMIPVKLLKSQGFYEGNTQIW 449
+K + K +PS + +Q PK A V +E+ ++ ++ PV+L K Q + + W
Sbjct: 457 QKKQEISKSKPSPSQWKQD-TPKSKAGYVQEEQKKQETPKLWPVQLQKEQDPKKQTPKSW 515

Query: 450 LPKVVAQSGTTK 485
P + ++ TTK
Sbjct: 516 TPSMQSEQNTTK 527


>sp|Q9PQW0|Y183_UREPA Uncharacterized protein UU183 OS=Ureaplasma
parvum GN=UU183 PE=4 SV=1
Length = 291

Score = 31.6 bits (70), Expect = 2.5
Identities = 24/80 (30%), Positives = 39/80 (48%), Gaps = 11/80 (13%)
Frame = +3

Query: 117 SNKSITAQGYFQGNANVWAKKPKLIA*TYPSQPTCSTKNKIRYKHK------TNNSNWRK 278
+N+++T + NAN++ K KLI TY + I Y + N NW+
Sbjct: 196 NNENLTFNPSYNYNANLYFTKAKLIYCTYTIIGIIFIISFIYYLSEIIKRCLLVNDNWKI 255

Query: 279 KNHKRQ-----KKRPSKQKM 323
K H+R+ KKR +KQ++
Sbjct: 256 KQHERKDGLNIKKRKNKQEI 275


>sp|Q5VWG9|TAF3_HUMAN Transcription initiation factor TFIID subunit
3 OS=Homo sapiens GN=TAF3 PE=1 SV=1
Length = 929

Score = 31.2 bits (69), Expect = 3.3
Identities = 15/63 (23%), Positives = 33/63 (52%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIPVKL 407
K K++ K K + +KK +++K++ K++ ++ + + + KH K ++ PV L
Sbjct: 693 KEKVKEKEKKKDKKEKKKKKEKEKEKKEKEREKEKREREKREKEKEKHKHEKIKVEPVAL 752

Query: 408 LKS 416
S
Sbjct: 753 APS 755


>sp|A7UXD4|CHL1_NEUCR ATP-dependent RNA helicase chl-1 OS=Neurospora
crassa GN=chl-1 PE=3 SV=1
Length = 1073

Score = 31.2 bits (69), Expect = 3.3
Identities = 12/27 (44%), Positives = 16/27 (59%)
Frame = +1

Query: 31 KEHIKVKDPVWIHEAWVQPQQQKVTGG 111
KEH++ K P WI E W + Q+Q G
Sbjct: 1021 KEHVRAKLPGWIREGWDETQRQAKEDG 1047


>sp|P21525|FOSL_DROME Transcription factor kayak OS=Drosophila
melanogaster GN=kay PE=1 SV=3
Length = 722

Score = 30.8 bits (68), Expect = 4.3
Identities = 20/80 (25%), Positives = 41/80 (51%), Gaps = 1/80 (1%)
Frame = +3

Query: 246 KHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIPVKLLKSQG- 422
+H NN+N N+ +Q + +Q+ +Q + + + TQ++ +Q ++P +S
Sbjct: 84 QHHINNNNSMNVNYNQQLTQQPQQQQQQTQYMQHNYNNYTQQQQ-QQHLVPATTSQSNSH 142

Query: 423 FYEGNTQIWLPKVVAQSGTT 482
FY+ N Q + +A + TT
Sbjct: 143 FYQCNQQQQQQQFLAPTTTT 162


>sp|P21401|VGLM_RVFVZ Envelope glycoprotein OS=Rift valley fever
virus (strain ZH-548 M12) GN=M PE=3 SV=1
Length = 1197

Score = 30.8 bits (68), Expect = 4.3
Identities = 19/71 (26%), Positives = 33/71 (46%)
Frame = -2

Query: 285 GFSFSNLSCLSCVYSGSCSL*NTLVEMGRSRLLI*AFWPKH*RFLGSIPEQ*LTYLMLPT 106
G + + +C Y+G+CS + L+E G+ L + H L ++ + + P+
Sbjct: 171 GMTQEDATCKPVTYAGACSSFDVLLEKGKFPLF--QSYAHHRTLLEAVHDTIIAKADPPS 228

Query: 105 CHLLLLWLNPC 73
C LL NPC
Sbjct: 229 CDLLSAHGNPC 239


>sp|Q3KRF1|SP110_RAT Sp110 nuclear body protein OS=Rattus norvegicus
GN=Sp110 PE=2 SV=1
Length = 478

Score = 30.4 bits (67), Expect = 5.6
Identities = 16/46 (34%), Positives = 22/46 (47%)
Frame = +3

Query: 204 PSQPTCSTKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VP 341
P + C+ NK K K+ W +RQKK+P + KM V P
Sbjct: 263 PQEAPCTPANKKARKRKS--CIWSNSKRRRQKKKPPQHKMMGVASP 306


tr_hit_id Q4Z2T9
Definition tr|Q4Z2T9|Q4Z2T9_PLABE Putative uncharacterized protein (Fragment) OS=Plasmodium berghei
Align length 101
Score (bit) 36.6
E-value 0.83
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912672|Adiantum capillus-veneris mRNA, clone:
YMU001_000021_E11.
(535 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4Z2T9|Q4Z2T9_PLABE Putative uncharacterized protein (Fragmen... 37 0.83
tr|A7RGZ8|A7RGZ8_NEMVE Predicted protein OS=Nematostella vectens... 36 1.1
tr|Q8MPX4|Q8MPX4_CAEEL Putative uncharacterized protein OS=Caeno... 36 1.4
tr|A7R151|A7R151_VITVI Chromosome undetermined scaffold_337, who... 35 3.2
tr|Q8IK49|Q8IK49_PLAF7 Putative uncharacterized protein OS=Plasm... 35 3.2
tr|Q4XMB8|Q4XMB8_PLACH Putative uncharacterized protein (Fragmen... 35 3.2
tr|B3L8M7|B3L8M7_PLAKH Putative uncharacterized protein OS=Plasm... 34 4.1
tr|A0BZ89|A0BZ89_PARTE Chromosome undetermined scaffold_139, who... 34 4.1
tr|Q7RSN1|Q7RSN1_PLAYO Putative uncharacterized protein PY00324 ... 34 5.4
tr|Q4N892|Q4N892_THEPA Putative uncharacterized protein OS=Theil... 34 5.4
tr|Q23BX2|Q23BX2_TETTH Putative uncharacterized protein OS=Tetra... 34 5.4
tr|B4GVL7|B4GVL7_DROPE GL14678 OS=Drosophila persimilis GN=GL146... 33 7.0
tr|A7RV08|A7RV08_NEMVE Predicted protein OS=Nematostella vectens... 33 7.0
tr|A2DMU1|A2DMU1_TRIVA Putative uncharacterized protein OS=Trich... 33 7.0
tr|A1L2X1|A1L2X1_XENLA LOC100036977 protein OS=Xenopus laevis GN... 33 9.2
tr|Q54ZW1|Q54ZW1_DICDI Putative uncharacterized protein OS=Dicty... 33 9.2
tr|A8N6P2|A8N6P2_COPC7 Putative uncharacterized protein OS=Copri... 33 9.2
tr|A3LPD1|A3LPD1_PICST Phosphatidylinositol-4-phosphate 5-kinase... 33 9.2

>tr|Q4Z2T9|Q4Z2T9_PLABE Putative uncharacterized protein (Fragment)
OS=Plasmodium berghei GN=PB102255.00.0 PE=4 SV=1
Length = 369

Score = 36.6 bits (83), Expect = 0.83
Identities = 30/101 (29%), Positives = 44/101 (43%), Gaps = 4/101 (3%)
Frame = +3

Query: 222 STKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLD--ASQVTQEKHVKQRMI 395
ST +K YK+ NN N K + K++KK+ K M + + D A++ +K + I
Sbjct: 97 STSSKFGYKNTLNNDNSSKSSEKKKKKKKMKNDMNGKVIKRNDNLANETIDKKKSASKNI 156

Query: 396 PVKL-LKSQGFYEGNTQIWLPKVVAQSGTTKKNHVH-KFLS 512
LK N I + TKKN+ H K LS
Sbjct: 157 SKSFNLKKNNIISSNINI--------NSNTKKNYKHGKILS 189


>tr|A7RGZ8|A7RGZ8_NEMVE Predicted protein OS=Nematostella vectensis
GN=v1g238183 PE=4 SV=1
Length = 1100

Score = 36.2 bits (82), Expect = 1.1
Identities = 25/97 (25%), Positives = 47/97 (48%), Gaps = 9/97 (9%)
Frame = +3

Query: 222 STKNKIRYKHKTNNSNWRKKNHKRQKKR-PSKQKMRQV*VPKLDASQVTQEKHVKQRMIP 398
+++ K + KHK ++ + +KK HK++KKR K K +Q K + + T++K K P
Sbjct: 183 NSEKKDKKKHKKHSKDKKKKKHKKEKKREKDKHKHKQ---EKESSDEETKDKESKNSSSP 239

Query: 399 VKLL--------KSQGFYEGNTQIWLPKVVAQSGTTK 485
K K + ++ PK +++ G+ K
Sbjct: 240 PKSAITREKDKSKIDSILDKPDELSTPKKISEKGSPK 276


>tr|Q8MPX4|Q8MPX4_CAEEL Putative uncharacterized protein
OS=Caenorhabditis elegans GN=spat-3 PE=2 SV=2
Length = 2471

Score = 35.8 bits (81), Expect = 1.4
Identities = 24/74 (32%), Positives = 38/74 (51%), Gaps = 5/74 (6%)
Frame = +3

Query: 207 SQPTCSTKNKI--RYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQE--- 371
S+P+CST K R + + + N + N ++KKR K+K VPK D S V+ E
Sbjct: 374 SKPSCSTSKKTTNRSRDSSESDNDSRDNELQKKKRKMKRKN----VPKTDGSDVSNESFD 429

Query: 372 KHVKQRMIPVKLLK 413
+ ++ KL+K
Sbjct: 430 EDASGEVVATKLIK 443


>tr|A7R151|A7R151_VITVI Chromosome undetermined scaffold_337, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00011778001 PE=4 SV=1
Length = 200

Score = 34.7 bits (78), Expect = 3.2
Identities = 18/62 (29%), Positives = 31/62 (50%)
Frame = +3

Query: 219 CSTKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIP 398
C K+RYK++ W KKN + P +QV VP+ S+ +EK ++ ++
Sbjct: 43 CLDHLKLRYKYQDIPIPWLKKNDHQNGGTPKDDDQQQVEVPRPKKSRSKKEKEDEEEVLL 102

Query: 399 VK 404
+K
Sbjct: 103 IK 104


>tr|Q8IK49|Q8IK49_PLAF7 Putative uncharacterized protein
OS=Plasmodium falciparum (isolate 3D7) GN=PF14_0758 PE=4
SV=1
Length = 1263

Score = 34.7 bits (78), Expect = 3.2
Identities = 25/90 (27%), Positives = 43/90 (47%)
Frame = +3

Query: 222 STKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIPV 401
S++NK ++K N+ + K K + +K + KLD+ EK+ ++ IP
Sbjct: 637 SSQNKTNSQNKQNSQDKTNKQSKLDTQNGKNEKNEKSIPNKLDSQNGKNEKN--EKSIPN 694

Query: 402 KLLKSQGFYEGNTQIWLPKVVAQSGTTKKN 491
KL G E N + K+ +Q+G +KN
Sbjct: 695 KLDSQNGKNEKNEKSIPNKLDSQNGKNEKN 724


>tr|Q4XMB8|Q4XMB8_PLACH Putative uncharacterized protein (Fragment)
OS=Plasmodium chabaudi GN=PC108904.00.0 PE=4 SV=1
Length = 285

Score = 34.7 bits (78), Expect = 3.2
Identities = 20/65 (30%), Positives = 30/65 (46%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIPVKL 407
+ K++ K K +KK K QKKR +QK Q K+ Q +K K+R K
Sbjct: 198 QKKMQKKQKKRQKRQKKKRKKGQKKRQKRQKKMQKRQKKMQKKQKKMQKKQKKRQKRQKK 257

Query: 408 LKSQG 422
+ +G
Sbjct: 258 KRKKG 262



Score = 33.5 bits (75), Expect = 7.0
Identities = 16/55 (29%), Positives = 29/55 (52%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRM 392
K K + + K +KK +++KKR +QK R+ K+ Q ++K K++M
Sbjct: 133 KKKRKKRQKKRQKRKKKKQKRKKKKRKKRQKKRKKRQKKMQKKQKKRQKRQKKKM 187



Score = 33.1 bits (74), Expect = 9.2
Identities = 18/54 (33%), Positives = 27/54 (50%)
Frame = +3

Query: 228 KNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQR 389
K K + + K +KK KRQKKR ++K RQ K Q ++K K++
Sbjct: 46 KKKKQKRKKKKQKRQKKKRKKRQKKRQKRKKKRQKRKKKKQKRQKKKQKRKKKK 99


>tr|B3L8M7|B3L8M7_PLAKH Putative uncharacterized protein
OS=Plasmodium knowlesi (strain H) GN=PKH_121730 PE=4
SV=1
Length = 385

Score = 34.3 bits (77), Expect = 4.1
Identities = 21/60 (35%), Positives = 38/60 (63%), Gaps = 2/60 (3%)
Frame = +3

Query: 231 NKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VP--KLDASQVTQEKHVKQRMIPVK 404
+K+ K+K NN +++KN K + ++ SK++ ++ P K+ +VT EK V +RM+P K
Sbjct: 9 DKVFEKYKNNNL-YKRKNEKEEVEQGSKKEAKEKKAPEKKVTEKKVT-EKKVTERMVPEK 66


>tr|A0BZ89|A0BZ89_PARTE Chromosome undetermined scaffold_139, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00033709001 PE=4 SV=1
Length = 351

Score = 34.3 bits (77), Expect = 4.1
Identities = 35/128 (27%), Positives = 54/128 (42%), Gaps = 2/128 (1%)
Frame = +3

Query: 132 TAQGYFQGNANVW--AKKPKLIA*TYPSQPTCSTKNKIRYKHKTNNSNWRKKNHKRQKKR 305
TA+ + + N+W AK+ K I QP KN I +K N+ + ++ K+R
Sbjct: 144 TAKQFTESFKNIWDQAKQAKFIDSQIVYQPN---KNCIEFKSYKKNTLKLRIKKRKFKRR 200

Query: 306 PSKQKMRQV*VPKLDASQVTQEKHVKQRMIPVKLLKSQGFYEGNTQIWLPKVVAQSGTTK 485
+QK Q + + +QEK QR+IP +K G YE + + T
Sbjct: 201 FRQQKQYQ----RFKSKNKSQEK---QRLIPELKVKEIGQYENSKGFQQSDEQQKMQFTN 253

Query: 486 KNHVHKFL 509
N FL
Sbjct: 254 SNKTQDFL 261


>tr|Q7RSN1|Q7RSN1_PLAYO Putative uncharacterized protein PY00324
OS=Plasmodium yoelii yoelii GN=PY00324 PE=4 SV=1
Length = 525

Score = 33.9 bits (76), Expect = 5.4
Identities = 28/98 (28%), Positives = 45/98 (45%), Gaps = 1/98 (1%)
Frame = +3

Query: 222 STKNKIRYKHKTNNSNWRKKNHKRQKKRPSKQKMRQV*VPKLDASQVTQEKHVKQRMIPV 401
ST +K YK+ NN N K + K++KK+ + V K + +T E K++
Sbjct: 109 STSSKFSYKNTLNNDNSSKSSEKKKKKKKKMKNDMNGKVIKKN-GDLTNELIDKKKSASK 167

Query: 402 KLLKSQGFYEGNTQIWLPKVVAQSGTTKKNHVH-KFLS 512
+ KS + N + + + TKKN+ H K LS
Sbjct: 168 NISKSFNLKKNNV---ISSNINITSNTKKNYKHGKMLS 202


>tr|Q4N892|Q4N892_THEPA Putative uncharacterized protein
OS=Theileria parva GN=TP01_0578 PE=4 SV=1
Length = 668

Score = 33.9 bits (76), Expect = 5.4
Identities = 31/130 (23%), Positives = 64/130 (49%), Gaps = 5/130 (3%)
Frame = +3

Query: 117 SNKSITAQGYFQGNANVWAKKPKLIA*TYPSQPTCSTKNKIRYKHKTNNSNWRKKNHKRQ 296
S + I +Q + ++ K K+ T P++ + K+K + K K+++ + K+ +
Sbjct: 6 SRRRIESQSSMESSS---LKSSKVTKDTSPTKSKPTEKDKTKSKEKSSSKD---KDKSKT 59

Query: 297 KKRPSKQKMRQV*VPKLDASQVTQEKHVKQRM----IPV-KLLKSQGFYEGNTQIWLPKV 461
K++PSK+K ++ PKL ++K VK + +P+ KL K G + ++ + +
Sbjct: 60 KEKPSKEKEKE--EPKLKEKSPPKDKSVKSKSKIVDLPLPKLKKPSGKVNNHDEVPISGI 117

Query: 462 VAQSGTTKKN 491
G KK+
Sbjct: 118 ---KGAAKKS 124