BP912674
Clone id YMU001_000021_F01
Library
Length 539
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000021_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GAGCACTGGAGATATGGAGAAAGGGGATGCGGATGCAGATGACACAGATGATGGCTTGAC
TGCAGAGGAGCCTGCAGAAAAGCCTGAGAGACTTCGCCAACGCTCGGCAAAGAAACTCTC
ATATGCAGAAGATGCTGATGAAGAGATGGATTGGGAATCTGATGAAGGGAGGGACATCGA
ACAGCTTTCAAGCAAGGCAAAAAAAAGAAGCAGAAAGCCGACTCCTGCTCAGTGTGCGGG
TCAGGAGACAAACTTACATTCTGTTACACTTGTCCAGAGGCATATCACCCAAGTTGCTTA
ACTCCCCCTCTCAAGGTTGCGCCAAGAGGCAGATGGAGCTGTCCTCATTGTGTTGATCCA
ATGTCAGAGATTGACAAATTTCTTGATTGTCAAATGCGGCCACAAGAGAATTTGGAAGAG
ACAGATGAATCTAAAGAGTCATTGACTCGGCAGTATCTCGTGAAATGGAAGTCAAGATCT
TACTTGCATTGTTCATGGCTTCCTGAGACTGAACTTGAGAAAGCCGCGAATTCTTCCAG
■■Homology search results ■■ -
sp_hit_id Q9S775
Definition sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE OS=Arabidopsis thaliana
Align length 104
Score (bit) 122.0
E-value 1.0e-27
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912674|Adiantum capillus-veneris mRNA, clone:
YMU001_000021_F01.
(522 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE... 122 1e-27
sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3... 92 2e-18
sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein M... 88 3e-17
sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3... 82 2e-15
sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4... 81 3e-15
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4... 81 3e-15
sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5... 75 1e-13
sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3... 70 5e-12
sp|Q6ZPK0|PF21A_MOUSE PHD finger protein 21A OS=Mus musculus GN=... 63 7e-10
sp|Q96BD5|PF21A_HUMAN PHD finger protein 21A OS=Homo sapiens GN=... 63 7e-10
sp|Q96EK2|PF21B_HUMAN PHD finger protein 21B OS=Homo sapiens GN=... 62 1e-09
sp|Q5F3R2|JAD1B_CHICK Histone demethylase JARID1B OS=Gallus gall... 55 9e-09
sp|O43918|AIRE_HUMAN Autoimmune regulator OS=Homo sapiens GN=AIR... 59 1e-08
sp|Q9Z0E3|AIRE_MOUSE Autoimmune regulator OS=Mus musculus GN=Air... 58 3e-08
sp|P58268|REQU_CHICK Zinc finger protein ubi-d4 OS=Gallus gallus... 57 4e-08
sp|Q8C966|PF21B_MOUSE PHD finger protein 21B OS=Mus musculus GN=... 57 5e-08
sp|Q5XUN4|JAD1D_PANTR Histone demethylase JARID1D OS=Pan troglod... 56 1e-07
sp|Q9BY66|JAD1D_HUMAN Histone demethylase JARID1D OS=Homo sapien... 56 1e-07
sp|Q80Y84|JAD1B_MOUSE Histone demethylase JARID1B OS=Mus musculu... 55 2e-07
sp|Q9UGL1|JAD1B_HUMAN Histone demethylase JARID1B OS=Homo sapien... 55 2e-07
sp|Q3UXZ9|JAD1A_MOUSE Histone demethylase JARID1A OS=Mus musculu... 55 2e-07
sp|P29375|JAD1A_HUMAN Histone demethylase JARID1A OS=Homo sapien... 55 2e-07
sp|Q9HB58|SP110_HUMAN Sp110 nuclear body protein OS=Homo sapiens... 55 3e-07
sp|Q6IQX0|JA1BB_DANRE Histone demethylase JARID1B-B OS=Danio rer... 55 3e-07
sp|Q9QX66|DPF1_MOUSE Zinc finger protein neuro-d4 OS=Mus musculu... 55 3e-07
sp|Q92785|REQU_HUMAN Zinc finger protein ubi-d4 OS=Homo sapiens ... 54 3e-07
sp|Q9W636|REQUB_XENLA Zinc finger protein ubi-d4 B (Fragment) OS... 54 5e-07
sp|Q61103|REQU_MOUSE Zinc finger protein ubi-d4 OS=Mus musculus ... 54 6e-07
sp|Q9W638|REQUA_XENLA Zinc finger protein ubi-d4 A OS=Xenopus la... 54 6e-07
sp|Q9VMJ7|JAD1_DROME Histone demethylase lid OS=Drosophila melan... 54 6e-07

>sp|Q9S775|PKL_ARATH CHD3-type chromatin-remodeling factor PICKLE
OS=Arabidopsis thaliana GN=PKL PE=1 SV=1
Length = 1384

Score = 122 bits (305), Expect = 1e-27
Identities = 53/104 (50%), Positives = 65/104 (62%), Gaps = 3/104 (2%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMR 399
++C CG L C TC A+H CL PPLK A W CP CV P++EIDK LDC+MR
Sbjct: 50 NACQACGESTNLVSCNTCTYAFHAKCLVPPLKDASVENWRCPECVSPLNEIDKILDCEMR 109

Query: 400 PQENLEETD---ESKESLTRQYLVKWKSRSYLHCSWLPETELEK 522
P ++ E+ E K +QYLVKWK SYLHCSW+PE E +K
Sbjct: 110 PTKSSEQGSSDAEPKPIFVKQYLVKWKGLSYLHCSWVPEKEFQK 153


>sp|O16102|CHD3_DROME Chromodomain-helicase-DNA-binding protein 3
OS=Drosophila melanogaster GN=Chd3 PE=2 SV=3
Length = 892

Score = 91.7 bits (226), Expect = 2e-18
Identities = 38/97 (39%), Positives = 53/97 (54%)
Frame = +1

Query: 226 CSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMRPQ 405
C VC G L C +CP YH +CL+PPLK P+G W CP C+ + +K L +
Sbjct: 38 CKVCSDGGDLLCCDSCPSVYHRTCLSPPLKSIPKGDWICPRCIPLPGKAEKILSWRWALD 97

Query: 406 ENLEETDESKESLTRQYLVKWKSRSYLHCSWLPETEL 516
++ E SK R+Y +KW SY HC W+PE ++
Sbjct: 98 RSV-ELRTSKGEKRREYFIKWHGMSYWHCEWIPEGQM 133


>sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2
homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2
Length = 1982

Score = 87.8 bits (216), Expect = 3e-17
Identities = 40/105 (38%), Positives = 54/105 (51%), Gaps = 7/105 (6%)
Frame = +1

Query: 226 CSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDP--MSEIDKFLDCQMR 399
C VC G +L C +CP AYH CL PPL P G W CP C P + +K + +
Sbjct: 440 CRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKIITWRWA 499

Query: 400 PQENLEETDESK-----ESLTRQYLVKWKSRSYLHCSWLPETELE 519
+ N + SK S R+Y +KW + SY HC W+PE +L+
Sbjct: 500 QRSNDDGPSTSKGSKNSNSRVREYFIKWHNMSYWHCEWVPEVQLD 544



Score = 63.5 bits (153), Expect = 6e-10
Identities = 24/44 (54%), Positives = 27/44 (61%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHC 351
D C VC G ++ C TCP AYH CL P L P G+WSCPHC
Sbjct: 378 DYCEVCQQGGEIILCDTCPRAYHLVCLEPELDEPPEGKWSCPHC 421


>sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3
homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2
Length = 1787

Score = 82.0 bits (201), Expect = 2e-15
Identities = 40/120 (33%), Positives = 57/120 (47%), Gaps = 20/120 (16%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCV--DPMSEIDKFLDCQ 393
D C +C + C TCP +YH C+ PPL P G WSCP C+ +P I+K L +
Sbjct: 329 DYCRICKETSNILLCDTCPSSYHAYCIDPPLTEIPEGEWSCPRCIIPEPAQRIEKILSWR 388

Query: 394 MR------PQENLEETDESKESL------------TRQYLVKWKSRSYLHCSWLPETELE 519
+ P E E + SK+ + R++ VKWK +Y C WL ET ++
Sbjct: 389 WKEISYPEPLECKEGEEASKDDVFLKPPRKMEPRREREFFVKWKYLAYWQCEWLSETLMD 448



Score = 54.7 bits (130), Expect = 3e-07
Identities = 19/44 (43%), Positives = 26/44 (59%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHC 351
++C VC +L C TC AYH +C+ ++ P G WSCPHC
Sbjct: 266 ENCEVCNQDGELMLCDTCTRAYHVACIDENMEQPPEGDWSCPHC 309


>sp|Q6PDQ2|CHD4_MOUSE Chromodomain-helicase-DNA-binding protein 4
OS=Mus musculus GN=Chd4 PE=1 SV=1
Length = 1915

Score = 81.3 bits (199), Expect = 3e-15
Identities = 43/113 (38%), Positives = 53/113 (46%), Gaps = 15/113 (13%)
Frame = +1

Query: 226 CSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDP--MSEIDKFLDCQM- 396
C VC G +L C TCP +YH CL PPL P G W CP C P ++ K L +
Sbjct: 445 CRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWG 504

Query: 397 ---------RPQENLEETDESKE---SLTRQYLVKWKSRSYLHCSWLPETELE 519
RP + T K RQ+ VKW+ SY HCSW+ E +LE
Sbjct: 505 QPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLE 557



Score = 65.9 bits (159), Expect = 1e-10
Identities = 24/44 (54%), Positives = 29/44 (65%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHC 351
D C VC G ++ C TCP AYH CL P ++ AP G+WSCPHC
Sbjct: 364 DYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHC 407


>sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4
OS=Homo sapiens GN=CHD4 PE=1 SV=1
Length = 1912

Score = 81.3 bits (199), Expect = 3e-15
Identities = 43/113 (38%), Positives = 53/113 (46%), Gaps = 15/113 (13%)
Frame = +1

Query: 226 CSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDP--MSEIDKFLDCQM- 396
C VC G +L C TCP +YH CL PPL P G W CP C P ++ K L +
Sbjct: 452 CRVCKDGGELLCCDTCPSSYHIHCLNPPLPEIPNGEWLCPRCTCPALKGKVQKILIWKWG 511

Query: 397 ---------RPQENLEETDESKE---SLTRQYLVKWKSRSYLHCSWLPETELE 519
RP + T K RQ+ VKW+ SY HCSW+ E +LE
Sbjct: 512 QPPSPTPVPRPPDADPNTPSPKPLEGRPERQFFVKWQGMSYWHCSWVSELQLE 564



Score = 65.9 bits (159), Expect = 1e-10
Identities = 24/44 (54%), Positives = 29/44 (65%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHC 351
D C VC G ++ C TCP AYH CL P ++ AP G+WSCPHC
Sbjct: 371 DYCEVCQQGGEIILCDTCPRAYHMVCLDPDMEKAPEGKWSCPHC 414


>sp|Q8TDI0|CHD5_HUMAN Chromodomain-helicase-DNA-binding protein 5
OS=Homo sapiens GN=CHD5 PE=2 SV=1
Length = 1954

Score = 75.5 bits (184), Expect = 1e-13
Identities = 39/114 (34%), Positives = 53/114 (46%), Gaps = 16/114 (14%)
Frame = +1

Query: 226 CSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDP--MSEIDKFLDCQMR 399
C VC G +L C CP +YH CL PPL P G W CP C P ++ + L +
Sbjct: 419 CRVCKDGGELLCCDACPSSYHLHCLNPPLPEIPNGEWLCPRCTCPPLKGKVQRILHWRWT 478

Query: 400 ----------PQENLEETDESKESL----TRQYLVKWKSRSYLHCSWLPETELE 519
P ++E + + L R++ VKW SY HCSW+ E +LE
Sbjct: 479 EPPAPFMVGLPGPDVEPSLPPPKPLEGIPEREFFVKWAGLSYWHCSWVKELQLE 532



Score = 66.2 bits (160), Expect = 9e-11
Identities = 25/44 (56%), Positives = 29/44 (65%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHC 351
D C VC G ++ C TCP AYH CL P L+ AP G+WSCPHC
Sbjct: 344 DYCEVCQQGGEIILCDTCPRAYHLVCLDPELEKAPEGKWSCPHC 387


>sp|Q12873|CHD3_HUMAN Chromodomain-helicase-DNA-binding protein 3
OS=Homo sapiens GN=CHD3 PE=1 SV=3
Length = 2000

Score = 70.5 bits (171), Expect = 5e-12
Identities = 38/113 (33%), Positives = 50/113 (44%), Gaps = 15/113 (13%)
Frame = +1

Query: 226 CSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPM--SEIDKFLDCQM- 396
C VC G +L C C +YH CL PPL P G W CP C P+ + K L +
Sbjct: 459 CRVCKDGGELLCCDACISSYHIHCLNPPLPDIPNGEWLCPRCTCPVLKGRVQKILHWRWG 518

Query: 397 -------RPQE-----NLEETDESKESLTRQYLVKWKSRSYLHCSWLPETELE 519
PQ+ ++ + R++ VKW SY HCSW E +LE
Sbjct: 519 EPPVAVPAPQQADGNPDVPPPRPLQGRSEREFFVKWVGLSYWHCSWAKELQLE 571



Score = 67.4 bits (163), Expect = 4e-11
Identities = 33/91 (36%), Positives = 45/91 (49%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMR 399
D C VC G ++ C TCP AYH CL P L AP G+WSCPHC + + + +
Sbjct: 380 DYCEVCQQGGEIILCDTCPRAYHLVCLDPELDRAPEGKWSCPHCEKEGVQWEAKEEEEEY 439

Query: 400 PQENLEETDESKESLTRQYLVKWKSRSYLHC 492
+E EE ++ +E +Y K L C
Sbjct: 440 EEEGEEEGEKEEEDDHMEYCRVCKDGGELLC 470


>sp|Q6ZPK0|PF21A_MOUSE PHD finger protein 21A OS=Mus musculus
GN=Phf21a PE=1 SV=2
Length = 659

Score = 63.2 bits (152), Expect = 7e-10
Identities = 25/48 (52%), Positives = 27/48 (56%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPM 363
D CSVC +L C TC YH CL PPLK P+G W CP C D M
Sbjct: 469 DFCSVCRKSGQLLMCDTCSRVYHLDCLEPPLKTIPKGMWICPRCQDQM 516


>sp|Q96BD5|PF21A_HUMAN PHD finger protein 21A OS=Homo sapiens
GN=PHF21A PE=1 SV=1
Length = 680

Score = 63.2 bits (152), Expect = 7e-10
Identities = 25/48 (52%), Positives = 27/48 (56%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPM 363
D CSVC +L C TC YH CL PPLK P+G W CP C D M
Sbjct: 489 DFCSVCRKSGQLLMCDTCSRVYHLDCLDPPLKTIPKGMWICPRCQDQM 536


tr_hit_id A9RX41
Definition tr|A9RX41|A9RX41_PHYPA SNF2 family DNA-dependent ATPase (Fragment) OS=Physcomitrella patens subsp. patens
Align length 110
Score (bit) 126.0
E-value 9.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912674|Adiantum capillus-veneris mRNA, clone:
YMU001_000021_F01.
(522 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9RX41|A9RX41_PHYPA SNF2 family DNA-dependent ATPase (Fragmen... 126 9e-31
tr|A9TI22|A9TI22_PHYPA SNF2 family DNA-dependent ATPase (Fragmen... 125 4e-29
tr|A7P5Y0|A7P5Y0_VITVI Chromosome chr4 scaffold_6, whole genome ... 120 5e-26
tr|Q6YNJ6|Q6YNJ6_ORYSA Chromatin-remodeling factor CHD3 OS=Oryza... 101 2e-20
tr|Q6YNJ5|Q6YNJ5_ORYSI Chromatin-remodeling factor CHD3 OS=Oryza... 101 2e-20
tr|Q5SML0|Q5SML0_ORYSJ Chromatin-remodeling factor CHD3 OS=Oryza... 101 2e-20
tr|Q0DE21|Q0DE21_ORYSJ Os06g0183800 protein (Fragment) OS=Oryza ... 101 2e-20
tr|B3NID0|B3NID0_DROER GG16034 OS=Drosophila erecta GN=Chd3 PE=4... 94 5e-18
tr|Q59E34|Q59E34_DROME Mi-2, isoform B OS=Drosophila melanogaste... 88 3e-16
tr|B4PFW6|B4PFW6_DROYA GE22457 OS=Drosophila yakuba GN=Dyak\GE22... 88 3e-16
tr|B4IIS0|B4IIS0_DROSE GM15785 OS=Drosophila sechellia GN=GM1578... 88 3e-16
tr|B3NE02|B3NE02_DROER GG13363 OS=Drosophila erecta GN=GG13363 P... 88 3e-16
tr|A7S9J4|A7S9J4_NEMVE Predicted protein OS=Nematostella vectens... 87 4e-16
tr|B4IIK5|B4IIK5_DROSE GM19418 OS=Drosophila sechellia GN=Chd3 P... 86 1e-15
tr|B3S0B1|B3S0B1_TRIAD Putative uncharacterized protein (Fragmen... 86 1e-15
tr|B4PGH5|B4PGH5_DROYA GE19602 OS=Drosophila yakuba GN=Chd3 PE=4... 84 4e-15
tr|B4L0W7|B4L0W7_DROMO GI13663 OS=Drosophila mojavensis GN=GI136... 84 6e-15
tr|A9TG47|A9TG47_PHYPA SNF2 family DNA-dependent ATPase OS=Physc... 83 1e-14
tr|A9S4A6|A9S4A6_PHYPA SNF2 family DNA-dependent ATPase (Fragmen... 83 1e-14
tr|B4QQG0|B4QQG0_DROSI GD14801 OS=Drosophila simulans GN=Chd3 PE... 83 1e-14
tr|B3M8T6|B3M8T6_DROAN GF10842 OS=Drosophila ananassae GN=GF1084... 83 1e-14
tr|B4IXP0|B4IXP0_DROGR GH16907 OS=Drosophila grimshawi GN=GH1690... 82 1e-14
tr|A9JRU7|A9JRU7_DANRE Wu:fd12d03 protein (Fragment) OS=Danio re... 82 2e-14
tr|A3KN93|A3KN93_XENTR Chd4 protein OS=Xenopus tropicalis GN=chd... 82 2e-14
tr|Q7PZN7|Q7PZN7_ANOGA AGAP012009-PA OS=Anopheles gambiae GN=AGA... 82 2e-14
tr|B4LBL9|B4LBL9_DROVI GJ13998 OS=Drosophila virilis GN=GJ13998 ... 82 2e-14
tr|Q7ZWN3|Q7ZWN3_XENLA B230399n07 protein OS=Xenopus laevis GN=c... 81 3e-14
tr|Q4T4E7|Q4T4E7_TETNG Chromosome undetermined SCAF9679, whole g... 81 3e-14
tr|Q8BM83|Q8BM83_MOUSE Putative uncharacterized protein (Fragmen... 81 3e-14
tr|Q5DTP7|Q5DTP7_MOUSE MKIAA4075 protein (Fragment) OS=Mus muscu... 81 3e-14

>tr|A9RX41|A9RX41_PHYPA SNF2 family DNA-dependent ATPase (Fragment)
OS=Physcomitrella patens subsp. patens GN=CHR1512 PE=4
SV=1
Length = 1220

Score = 126 bits (317), Expect(2) = 9e-31
Identities = 54/110 (49%), Positives = 75/110 (68%), Gaps = 9/110 (8%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMR 399
D CS+C G L C TC +H CL PP+KV PRG+WSCP CV+P+ +++KF+D QMR
Sbjct: 54 DFCSICHLGGDLLCCDTCTAVFHLGCLDPPMKVVPRGKWSCPKCVNPLGDVEKFIDTQMR 113

Query: 400 PQE-------NLEE--TDESKESLTRQYLVKWKSRSYLHCSWLPETELEK 522
P + N+E+ +++ + L +QYLVKWKSRSYLHCSW+ +LE+
Sbjct: 114 PMKVPGKLPVNVEDKGSEDQPQKLVKQYLVKWKSRSYLHCSWVTAEDLER 163



Score = 30.4 bits (67), Expect(2) = 9e-31
Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 4/44 (9%)
Frame = +2

Query: 86 ERLRQRSAKKLSYAEDAD--EEMDW--ESDEGRDIEQLSSKAKK 205
ERLRQR+ +K Y E+ + EE +W E+DEG + E + K
Sbjct: 5 ERLRQRTNRKPVYVEEEEGMEEDEWEEEADEGEEEEDEEKEVLK 48


>tr|A9TI22|A9TI22_PHYPA SNF2 family DNA-dependent ATPase (Fragment)
OS=Physcomitrella patens subsp. patens GN=CHR1504 PE=4
SV=1
Length = 1245

Score = 125 bits (315), Expect(2) = 4e-29
Identities = 55/110 (50%), Positives = 73/110 (66%), Gaps = 9/110 (8%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMR 399
D CS+C G L C TC +H CL PP+KV PRG+WSCP CV+P+ +++KF+D QMR
Sbjct: 54 DFCSICHLGGDLLCCDTCTAVFHLGCLDPPMKVVPRGKWSCPKCVNPLGDVEKFIDTQMR 113

Query: 400 PQE-------NLEE--TDESKESLTRQYLVKWKSRSYLHCSWLPETELEK 522
P + N EE +++ L +QYLVKWKSRSYLHCSW+ +LE+
Sbjct: 114 PMKVPGRIAHNAEEKVSEDQPPKLVKQYLVKWKSRSYLHCSWVTAEDLER 163



Score = 25.8 bits (55), Expect(2) = 4e-29
Identities = 15/42 (35%), Positives = 25/42 (59%), Gaps = 2/42 (4%)
Frame = +2

Query: 86 ERLRQRSAKKLSYAEDAD--EEMDWESDEGRDIEQLSSKAKK 205
ERLRQR+ +K Y E+ + E +WE +E + E+ + K+
Sbjct: 5 ERLRQRTNRKPIYVEEEEGMEGDEWE-EEADEFEEEEDEEKE 45


>tr|A7P5Y0|A7P5Y0_VITVI Chromosome chr4 scaffold_6, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00032703001
PE=4 SV=1
Length = 692

Score = 120 bits (300), Expect = 5e-26
Identities = 53/104 (50%), Positives = 63/104 (60%), Gaps = 3/104 (2%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMR 399
DSC CG L C TC AYHP CL PPLK W CP CV P+++IDK LDC+MR
Sbjct: 52 DSCQACGESGNLLSCETCTYAYHPKCLLPPLKAPLPSNWRCPQCVSPLNDIDKILDCEMR 111

Query: 400 PQ---ENLEETDESKESLTRQYLVKWKSRSYLHCSWLPETELEK 522
P ++ SK+ +QYLVKWK SYLHC+W+PE E K
Sbjct: 112 PTVAGDSDASKLGSKQIFVKQYLVKWKGLSYLHCTWVPEKEFIK 155


>tr|Q6YNJ6|Q6YNJ6_ORYSA Chromatin-remodeling factor CHD3 OS=Oryza
sativa GN=PKL PE=2 SV=1
Length = 1360

Score = 101 bits (252), Expect = 2e-20
Identities = 44/102 (43%), Positives = 62/102 (60%), Gaps = 4/102 (3%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMR 399
D+C CG D L C TC A+H CL P L + +WSCP CV P++E++K LDC+
Sbjct: 62 DACQKCGENDNLVPCSTCTYAFHRKCLVPRLNITS-DKWSCPECVSPLTEMEKILDCEET 120

Query: 400 PQENLEETDE----SKESLTRQYLVKWKSRSYLHCSWLPETE 513
+ EET SK+ ++YL+KWK S+LHC+W+ E+E
Sbjct: 121 KPDASEETSSSESGSKKKPVKRYLIKWKGISHLHCTWVSESE 162


>tr|Q6YNJ5|Q6YNJ5_ORYSI Chromatin-remodeling factor CHD3 OS=Oryza
sativa subsp. indica GN=PKL PE=4 SV=1
Length = 1111

Score = 101 bits (252), Expect = 2e-20
Identities = 44/102 (43%), Positives = 62/102 (60%), Gaps = 4/102 (3%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMR 399
D+C CG D L C TC A+H CL P L + +WSCP CV P++E++K LDC+
Sbjct: 62 DACQKCGENDNLVPCSTCTYAFHRKCLVPRLNITS-DKWSCPECVSPLTEMEKILDCEET 120

Query: 400 PQENLEETDE----SKESLTRQYLVKWKSRSYLHCSWLPETE 513
+ EET SK+ ++YL+KWK S+LHC+W+ E+E
Sbjct: 121 KPDASEETSSSESGSKKKPVKRYLIKWKGISHLHCTWVSESE 162


>tr|Q5SML0|Q5SML0_ORYSJ Chromatin-remodeling factor CHD3 OS=Oryza
sativa subsp. japonica GN=OSJNBb0036B04.22 PE=4 SV=1
Length = 1354

Score = 101 bits (252), Expect = 2e-20
Identities = 44/102 (43%), Positives = 62/102 (60%), Gaps = 4/102 (3%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMR 399
D+C CG D L C TC A+H CL P L + +WSCP CV P++E++K LDC+
Sbjct: 56 DACQKCGENDNLVPCSTCTYAFHRKCLVPRLNITS-DKWSCPECVSPLTEMEKILDCEET 114

Query: 400 PQENLEETDE----SKESLTRQYLVKWKSRSYLHCSWLPETE 513
+ EET SK+ ++YL+KWK S+LHC+W+ E+E
Sbjct: 115 KPDASEETSSSESGSKKKPVKRYLIKWKGISHLHCTWVSESE 156


>tr|Q0DE21|Q0DE21_ORYSJ Os06g0183800 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os06g0183800 PE=4 SV=1
Length = 1335

Score = 101 bits (252), Expect = 2e-20
Identities = 44/102 (43%), Positives = 62/102 (60%), Gaps = 4/102 (3%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMR 399
D+C CG D L C TC A+H CL P L + +WSCP CV P++E++K LDC+
Sbjct: 37 DACQKCGENDNLVPCSTCTYAFHRKCLVPRLNITS-DKWSCPECVSPLTEMEKILDCEET 95

Query: 400 PQENLEETDE----SKESLTRQYLVKWKSRSYLHCSWLPETE 513
+ EET SK+ ++YL+KWK S+LHC+W+ E+E
Sbjct: 96 KPDASEETSSSESGSKKKPVKRYLIKWKGISHLHCTWVSESE 137


>tr|B3NID0|B3NID0_DROER GG16034 OS=Drosophila erecta GN=Chd3 PE=4
SV=1
Length = 869

Score = 93.6 bits (231), Expect = 5e-18
Identities = 39/97 (40%), Positives = 52/97 (53%)
Frame = +1

Query: 226 CSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDPMSEIDKFLDCQMRPQ 405
C VC G L C +CP YH +CLTPPLK P+G W CP C+ + +K L R
Sbjct: 11 CRVCRDGGDLLCCDSCPSVYHRTCLTPPLKSIPKGDWICPRCIPLPGKAEKIL--SWRWT 68

Query: 406 ENLEETDESKESLTRQYLVKWKSRSYLHCSWLPETEL 516
T S + R+Y +KW +SY HC W+PE ++
Sbjct: 69 LGRRSTSRSSQGAVREYFIKWYDKSYWHCEWIPEGQM 105


>tr|Q59E34|Q59E34_DROME Mi-2, isoform B OS=Drosophila melanogaster
GN=Mi-2 PE=2 SV=1
Length = 1983

Score = 87.8 bits (216), Expect = 3e-16
Identities = 40/105 (38%), Positives = 54/105 (51%), Gaps = 7/105 (6%)
Frame = +1

Query: 226 CSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDP--MSEIDKFLDCQMR 399
C VC G +L C +CP AYH CL PPL P G W CP C P + +K + +
Sbjct: 441 CRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKIITWRWA 500

Query: 400 PQENLEETDESK-----ESLTRQYLVKWKSRSYLHCSWLPETELE 519
+ N + SK S R+Y +KW + SY HC W+PE +L+
Sbjct: 501 QRSNDDGPSTSKGSKNSNSRVREYFIKWHNMSYWHCEWVPEVQLD 545



Score = 63.5 bits (153), Expect = 6e-09
Identities = 24/44 (54%), Positives = 27/44 (61%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHC 351
D C VC G ++ C TCP AYH CL P L P G+WSCPHC
Sbjct: 379 DYCEVCQQGGEIILCDTCPRAYHLVCLEPELDEPPEGKWSCPHC 422


>tr|B4PFW6|B4PFW6_DROYA GE22457 OS=Drosophila yakuba GN=Dyak\GE22457
PE=4 SV=1
Length = 1982

Score = 87.8 bits (216), Expect = 3e-16
Identities = 39/105 (37%), Positives = 54/105 (51%), Gaps = 7/105 (6%)
Frame = +1

Query: 226 CSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHCVDP--MSEIDKFLDCQMR 399
C VC G +L C +CP AYH CL PPL P G W CP C P + +K + +
Sbjct: 440 CRVCKDGGELLCCDSCPSAYHTFCLNPPLDTIPDGDWRCPRCSCPPLTGKAEKIITWRWA 499

Query: 400 PQEN-----LEETDESKESLTRQYLVKWKSRSYLHCSWLPETELE 519
+ N + +S S R+Y +KW + SY HC W+PE +L+
Sbjct: 500 QRSNDDGPSTSKGSKSSNSRVREYFIKWHNMSYWHCEWVPEVQLD 544



Score = 63.5 bits (153), Expect = 6e-09
Identities = 24/44 (54%), Positives = 27/44 (61%)
Frame = +1

Query: 220 DSCSVCGSGDKLTFCYTCPEAYHPSCLTPPLKVAPRGRWSCPHC 351
D C VC G ++ C TCP AYH CL P L P G+WSCPHC
Sbjct: 378 DYCEVCQQGGEIILCDTCPRAYHLVCLEPELDEPPEGKWSCPHC 421