BP912685
Clone id YMU001_000021_F12
Library
Length 535
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000021_F12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTTGGCAAATGAGTCACTGTAAGCAGCCATGCCAAGGGGCTGTAGCACAGAAATACTCCA
TCCCTTTTACTTGAAACTCAAATCAGCATCCTTCTCTTCATGGGGCGCTTGCTCCTAGCA
CTTGCATCATCATCATTGTCAGCTTGCCCTTCACTGTCATCCTCACCAGCCCCCAGCTCA
ATTGTTAATTCGCATGGTTCAGATGAAGTGCGGCCTCTATTTCGAGAATTTTTCCTAATG
GGAGTAGAAGGGGCCTGAGAAGCCATAGCCTGCTGACTCCTCTTGGGCATAAGCTCTGCC
CCTTGTTCCACCATCTCCTTCATCAAAATCCAGTCTTTGAAGTCAAATCTAAAGACAAAT
TGAGTATTCACAACTTGTTGCTGTTCTTCAACTCCCTGAGGCCTCCCTGCCCTTTCAGCA
GCAGTAGGAGCATACCTGAATGCCACAAACTGCTTTCCATCCTGTATTGTAATTTGGGCA
CGACCATCTTTCACCAAAAATGAGAGAGAGAAGATATTTTCTACAGTATGAGAAA
■■Homology search results ■■ -
sp_hit_id Q566X8
Definition sp|Q566X8|DMX1B_DANRE Diencephalon/mesencephalon homeobox protein 1-B OS=Danio rerio
Align length 75
Score (bit) 36.6
E-value 0.078
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912685|Adiantum capillus-veneris mRNA, clone:
YMU001_000021_F12.
(535 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q566X8|DMX1B_DANRE Diencephalon/mesencephalon homeobox protei... 37 0.078
sp|Q9NXX6|NSE4A_HUMAN Non-SMC element 4 homolog A OS=Homo sapien... 35 0.23
sp|Q54I56|SMC6_DICDI Structural maintenance of chromosomes prote... 33 1.1
sp|A5LFW4|EID3_MACFA EP300-interacting inhibitor of differentiat... 33 1.1
sp|Q8N140|EID3_HUMAN EP300-interacting inhibitor of differentiat... 33 1.1
sp|Q2TBI1|NSE4A_BOVIN Non-SMC element 4 homolog A OS=Bos taurus ... 32 1.5
sp|Q9WU62|INCE_MOUSE Inner centromere protein OS=Mus musculus GN... 32 1.9
sp|Q4V8G2|EID3_RAT EP300-interacting inhibitor of differentiatio... 32 2.5
sp|Q3V124|EID3_MOUSE EP300-interacting inhibitor of differentiat... 32 2.5
sp|A6QPC8|EID3_BOVIN EP300-interacting inhibitor of differentiat... 32 2.5
sp|Q54XM9|TAF11_DICDI Transcription initiation factor TFIID subu... 31 3.3
sp|A5I4J3|IF2_CLOBH Translation initiation factor IF-2 OS=Clostr... 31 3.3
sp|A7FVZ3|IF2_CLOB1 Translation initiation factor IF-2 OS=Clostr... 31 3.3
sp|A6SMQ7|CHZ1_BOTFB Histone H2A.Z-specific chaperone chz1 OS=Bo... 31 4.3
sp|P43124|NSE4_YEAST Non-structural maintenance of chromosome el... 30 5.6
sp|A7GG06|IF2_CLOBL Translation initiation factor IF-2 OS=Clostr... 30 5.6
sp|Q498L2|SLTM_XENLA SAFB-like transcription modulator OS=Xenopu... 30 7.3
sp|Q4P5U4|DBP4_USTMA ATP-dependent RNA helicase DBP4 OS=Ustilago... 30 7.3
sp|Q9NQS7|INCE_HUMAN Inner centromere protein OS=Homo sapiens GN... 30 9.5
sp|Q6CFT1|ESF2_YARLI Pre-rRNA-processing protein ESF2 OS=Yarrowi... 30 9.5
sp|O14647|CHD2_HUMAN Chromodomain-helicase-DNA-binding protein 2... 30 9.5
sp|Q4WMI1|BFR2_ASPFU Protein bfr2 OS=Aspergillus fumigatus GN=bf... 30 9.5

>sp|Q566X8|DMX1B_DANRE Diencephalon/mesencephalon homeobox protein
1-B OS=Danio rerio GN=dmbx1b PE=2 SV=1
Length = 369

Score = 36.6 bits (83), Expect = 0.078
Identities = 21/75 (28%), Positives = 34/75 (45%)
Frame = -3

Query: 323 MKEMVEQGAELMPKRSQQAMASQAPSTPIRKNSRNRGRTSSEPCELTIELGAGEDDSEGQ 144
+KE +GA+ K + +QAP +P+ RG TS+ CEL E+ + G
Sbjct: 136 LKEAGTEGAQDEGKEEAPPVEAQAPPSPL----DGRGLTSAPSCELNEEVNVTSPEQSGA 191

Query: 143 ADNDDDASARSKRPM 99
+D + R P+
Sbjct: 192 ESGAEDTTDREDEPL 206


>sp|Q9NXX6|NSE4A_HUMAN Non-SMC element 4 homolog A OS=Homo sapiens
GN=NSMCE4A PE=1 SV=2
Length = 385

Score = 35.0 bits (79), Expect = 0.23
Identities = 22/66 (33%), Positives = 34/66 (51%)
Frame = -3

Query: 527 TVENIFSLSFLVKDGRAQITIQDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFVFR 348
TVENIF +SF+++DG A+I + + V P + +G E QV N Q +
Sbjct: 301 TVENIFHVSFIIRDGFARIRLDQDRLPV---IEPVSINEEN--EGFEHNTQVRN-QGIIA 354

Query: 347 FDFKDW 330
++DW
Sbjct: 355 LSYRDW 360


>sp|Q54I56|SMC6_DICDI Structural maintenance of chromosomes protein
6 OS=Dictyostelium discoideum GN=smc6 PE=3 SV=1
Length = 1185

Score = 32.7 bits (73), Expect = 1.1
Identities = 24/114 (21%), Positives = 49/114 (42%), Gaps = 14/114 (12%)
Frame = -3

Query: 389 EEQQQVVNTQFVFRFDFKDWILMKEMVEQGAELMPKRSQQAMASQAPST-----PIRKNS 225
EE+++ + + + +D ++ VE G ++ P + Q Q P + ++ S
Sbjct: 20 EEEEEDDDDELIHSTQDQDRPHKQQRVENGKQMTPTKQHQQQQQQQPISNGRLKKLKAQS 79

Query: 224 RNRGRTSSEPCELTIEL---------GAGEDDSEGQADNDDDASARSKRPMKRR 90
+ SSE + +E + +DD + D+DDD ++ +R RR
Sbjct: 80 SDEESGSSEDDDEDVEDVDSSGSDSGSSDDDDDDDDDDDDDDGNSEDEREAVRR 133


>sp|A5LFW4|EID3_MACFA EP300-interacting inhibitor of differentiation
3 OS=Macaca fascicularis GN=EID3 PE=2 SV=1
Length = 371

Score = 32.7 bits (73), Expect = 1.1
Identities = 14/27 (51%), Positives = 21/27 (77%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQDGK 453
S TVENIF +SF+V+DG A+I + + +
Sbjct: 291 SRTVENIFYVSFIVRDGFARIRLDEDR 317


>sp|Q8N140|EID3_HUMAN EP300-interacting inhibitor of differentiation
3 OS=Homo sapiens GN=EID3 PE=1 SV=1
Length = 333

Score = 32.7 bits (73), Expect = 1.1
Identities = 14/27 (51%), Positives = 21/27 (77%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQDGK 453
S TVENIF +SF+V+DG A+I + + +
Sbjct: 253 SRTVENIFYVSFIVRDGFARIRLDEDR 279


>sp|Q2TBI1|NSE4A_BOVIN Non-SMC element 4 homolog A OS=Bos taurus
GN=NSMCE4A PE=2 SV=1
Length = 382

Score = 32.3 bits (72), Expect = 1.5
Identities = 19/66 (28%), Positives = 30/66 (45%)
Frame = -3

Query: 527 TVENIFSLSFLVKDGRAQITIQDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFVFR 348
TVENIF +SF+++DG A+I + D + E G Q + Q +
Sbjct: 301 TVENIFHVSFIIRDGFARIRL-DRDRLPVIEPVNINEESGGNTQ--------IRNQAIIA 351

Query: 347 FDFKDW 330
++DW
Sbjct: 352 LSYRDW 357


>sp|Q9WU62|INCE_MOUSE Inner centromere protein OS=Mus musculus
GN=Incenp PE=1 SV=2
Length = 880

Score = 32.0 bits (71), Expect = 1.9
Identities = 20/53 (37%), Positives = 28/53 (52%)
Frame = -3

Query: 359 FVFRFDFKDWILMKEMVEQGAELMPKRSQQAMASQAPSTPIRKNSRNRGRTSS 201
FV D KD++ +KE +E+ AE M R P TP +KN R + R S+
Sbjct: 22 FVCNVDNKDFMWLKE-IEEEAERMFIREFSNEPELMPKTPSQKNRRKKRRVSN 73


>sp|Q4V8G2|EID3_RAT EP300-interacting inhibitor of differentiation 3
OS=Rattus norvegicus GN=Eid3 PE=2 SV=2
Length = 387

Score = 31.6 bits (70), Expect = 2.5
Identities = 13/27 (48%), Positives = 20/27 (74%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQDGK 453
S TVENIF +SF+++DG A+I + +
Sbjct: 308 SRTVENIFYVSFIIRDGFARIRLDQDR 334


>sp|Q3V124|EID3_MOUSE EP300-interacting inhibitor of differentiation
3 OS=Mus musculus GN=Eid3 PE=2 SV=1
Length = 375

Score = 31.6 bits (70), Expect = 2.5
Identities = 13/27 (48%), Positives = 20/27 (74%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQDGK 453
S TVENIF +SF+++DG A+I + +
Sbjct: 296 SRTVENIFYVSFIIRDGFARIRLDQDR 322


>sp|A6QPC8|EID3_BOVIN EP300-interacting inhibitor of differentiation
3 OS=Bos taurus GN=EID3 PE=2 SV=1
Length = 379

Score = 31.6 bits (70), Expect = 2.5
Identities = 13/27 (48%), Positives = 20/27 (74%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQDGK 453
S TVENIF +SF+++DG A+I + +
Sbjct: 300 SRTVENIFYVSFIIRDGFARIRLDQDR 326


tr_hit_id A9TPF3
Definition tr|A9TPF3|A9TPF3_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 151
Score (bit) 105.0
E-value 2.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912685|Adiantum capillus-veneris mRNA, clone:
YMU001_000021_F12.
(535 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TPF3|A9TPF3_PHYPA Predicted protein (Fragment) OS=Physcomit... 105 2e-21
tr|B4FDX3|B4FDX3_MAIZE Putative uncharacterized protein OS=Zea m... 97 4e-19
tr|B6TF46|B6TF46_MAIZE Putative uncharacterized protein OS=Zea m... 96 9e-19
tr|B4FSE7|B4FSE7_MAIZE Putative uncharacterized protein OS=Zea m... 96 9e-19
tr|A7PVV4|A7PVV4_VITVI Chromosome chr8 scaffold_34, whole genome... 91 5e-17
tr|A7NZZ7|A7NZZ7_VITVI Chromosome chr6 scaffold_3, whole genome ... 89 1e-16
tr|Q9C689|Q9C689_ARATH Putative uncharacterized protein F23H24.4... 88 3e-16
tr|B8AJA9|B8AJA9_ORYSI Putative uncharacterized protein OS=Oryza... 86 2e-15
tr|Q7EXY7|Q7EXY7_ORYSJ Os08g0510900 protein OS=Oryza sativa subs... 81 3e-14
tr|B8BCB8|B8BCB8_ORYSI Putative uncharacterized protein OS=Oryza... 81 3e-14
tr|Q69XQ4|Q69XQ4_ORYSJ Os06g0618000 protein OS=Oryza sativa subs... 78 2e-13
tr|B8B4M1|B8B4M1_ORYSI Putative uncharacterized protein OS=Oryza... 78 2e-13
tr|B6V8G0|B6V8G0_HELAN COG5125-like protein OS=Helianthus annuus... 77 4e-13
tr|A3BUR1|A3BUR1_ORYSJ Putative uncharacterized protein OS=Oryza... 77 7e-13
tr|A3A434|A3A434_ORYSJ Putative uncharacterized protein OS=Oryza... 74 4e-12
tr|Q9LT44|Q9LT44_ARATH Arabidopsis thaliana genomic DNA, chromos... 72 1e-11
tr|Q6K3M6|Q6K3M6_ORYSJ Putative uncharacterized protein OSJNBb00... 59 1e-07
tr|A8J9Q8|A8J9Q8_CHLRE Predicted protein OS=Chlamydomonas reinha... 52 2e-05
tr|A7RIG0|A7RIG0_NEMVE Predicted protein OS=Nematostella vectens... 46 0.001
tr|B6N5Z4|B6N5Z4_BRAFL Putative uncharacterized protein OS=Branc... 45 0.002
tr|A6QTK1|A6QTK1_AJECN Putative uncharacterized protein OS=Ajell... 44 0.004
tr|Q1DSE4|Q1DSE4_COCIM Putative uncharacterized protein OS=Cocci... 44 0.005
tr|B8B6H7|B8B6H7_ORYSI Putative uncharacterized protein OS=Oryza... 43 0.012
tr|B2WHM7|B2WHM7_PYRTR Putative uncharacterized protein OS=Pyren... 42 0.020
tr|B8MDA1|B8MDA1_9EURO Nuclear protein Qri2/Nse4, putative OS=Ta... 42 0.026
tr|A1CAJ2|A1CAJ2_ASPCL Nuclear protein Qri2/Nse4, putative OS=As... 40 0.057
tr|Q2U4A2|Q2U4A2_ASPOR Uncharacterized conserved protein OS=Aspe... 40 0.075
tr|B8NTQ8|B8NTQ8_ASPFL Nuclear protein Qri2/Nse4, putative OS=As... 40 0.075
tr|Q0CKJ6|Q0CKJ6_ASPTN Putative uncharacterized protein OS=Asper... 40 0.098
tr|B6HNJ0|B6HNJ0_PENCH Pc21g00580 protein OS=Penicillium chrysog... 40 0.098

>tr|A9TPF3|A9TPF3_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_148594 PE=4 SV=1
Length = 321

Score = 105 bits (261), Expect = 2e-21
Identities = 69/151 (45%), Positives = 87/151 (57%), Gaps = 4/151 (2%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITI-QDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQF 357
S TVENIFSLSFL+KDGRA IT +DG VA + AP++ +R + QV NTQF
Sbjct: 188 SQTVENIFSLSFLIKDGRAAITYDKDGTHLVAPKNAPSSHDR--------QSGQVTNTQF 239

Query: 356 VFRFDFKDWILMKEMVEQGAELMPKRSQ--QAMASQAPSTPIRKNSRNRGRTSSEPCELT 183
VFR+D+ W M+E +E GAELMP R + + STPIRK+SRNRGR S
Sbjct: 240 VFRYDWTCWQTMQEKLEAGAELMPDRQSTLDPLLQPSQSTPIRKHSRNRGRESR------ 293

Query: 182 IELGAGEDDSEGQADNDDDASAR-SKRPMKR 93
A +++G +DA R SKR R
Sbjct: 294 ---NANNPENDGDDVEPEDAGQRHSKRARGR 321


>tr|B4FDX3|B4FDX3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 396

Score = 97.4 bits (241), Expect = 4e-19
Identities = 65/148 (43%), Positives = 76/148 (51%), Gaps = 14/148 (9%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQD-GKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQF 357
+ TVENIF+LSFLVKDGR +I + D G FV R AP A+ A VV F
Sbjct: 226 AQTVENIFALSFLVKDGRVEIKVNDQGHHFVYPRNAPVASAVASG--------DVVYNHF 277

Query: 356 VFRFDFKDWILMKEMVEQGAELMPKRSQQAMAS-------------QAPSTPIRKNSRNR 216
VFRFDFKDW LMK +V +G ELMP RS Q +A+ PST IRK RNR
Sbjct: 278 VFRFDFKDWKLMKGVVPEGEELMPHRSSQTIANTGGNNPTQSEAPLATPSTTIRKLCRNR 337

Query: 215 GRTSSEPCELTIELGAGEDDSEGQADND 132
G + T G E + ND
Sbjct: 338 GLILQDELIATGAYGVMEQEMLAMGTND 365


>tr|B6TF46|B6TF46_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 352

Score = 96.3 bits (238), Expect = 9e-19
Identities = 55/118 (46%), Positives = 72/118 (61%), Gaps = 11/118 (9%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFV 354
+ TVEN+F+LSFLVKDGR +IT+ D V R AP A+ A +V + FV
Sbjct: 215 AQTVENVFALSFLVKDGRVEITVDDSGHIVRPRNAPAASAIASG--------EVSYSHFV 266

Query: 353 FRFDFKDWILMKEMVEQGAELMPKRSQQA-----------MASQAPSTPIRKNSRNRG 213
FRFDFKDW LMKE+V +G EL+P R+ Q+ + ++A TPIRK +RNRG
Sbjct: 267 FRFDFKDWKLMKEVVTEGEELLPHRTSQSNLCNEENDQPNLEARAQITPIRKLTRNRG 324


>tr|B4FSE7|B4FSE7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 352

Score = 96.3 bits (238), Expect = 9e-19
Identities = 55/118 (46%), Positives = 72/118 (61%), Gaps = 11/118 (9%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQFV 354
+ TVEN+F+LSFLVKDGR +IT+ D V R AP A+ A +V + FV
Sbjct: 215 AQTVENVFALSFLVKDGRVEITVDDSGHIVRPRNAPAASAIASG--------EVSYSHFV 266

Query: 353 FRFDFKDWILMKEMVEQGAELMPKRSQQA-----------MASQAPSTPIRKNSRNRG 213
FRFDFKDW LMKE+V +G EL+P R+ Q+ + ++A TPIRK +RNRG
Sbjct: 267 FRFDFKDWKLMKEVVTEGEELLPHRTSQSNLCNEENDQPNLEARAQITPIRKLTRNRG 324


>tr|A7PVV4|A7PVV4_VITVI Chromosome chr8 scaffold_34, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025372001
PE=4 SV=1
Length = 380

Score = 90.5 bits (223), Expect = 5e-17
Identities = 61/146 (41%), Positives = 78/146 (53%), Gaps = 15/146 (10%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQD-GKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQF 357
+ TVEN+F+LSFLVKDGRA+IT+ G V+ R AP A +V F
Sbjct: 232 AQTVENLFALSFLVKDGRAEITVDGRGCHLVSPRNAPAA--------NAVVSGEVCYNHF 283

Query: 356 VFRFDFKDWILMKEMVEQGAELMPKR--------------SQQAMASQAPSTPIRKNSRN 219
VFRFDFKDW LM V G ELMP+R +++ A+ AP+TPIRK SRN
Sbjct: 284 VFRFDFKDWKLMATSVGAGEELMPQRNSVNLPNNSQTDSVAEECEAAAAPTTPIRKLSRN 343

Query: 218 RGRTSSEPCELTIELGAGEDDSEGQA 141
RG E + +E DD+ +A
Sbjct: 344 RGLVLQE--QAVVEDSPESDDAGTRA 367


>tr|A7NZZ7|A7NZZ7_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00024708001
PE=4 SV=1
Length = 377

Score = 89.0 bits (219), Expect = 1e-16
Identities = 65/159 (40%), Positives = 85/159 (53%), Gaps = 14/159 (8%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITI-QDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQF 357
+ TVEN+F+LSFLVKDGRA++ + ++G V+ + AP A+ R +VV + F
Sbjct: 233 ARTVENLFALSFLVKDGRAEVVVDENGSHLVSPKNAPAASSVVAR--------EVVYSHF 284

Query: 356 VFRFDFKDWILMKEMVEQGAELMP--KRSQQAMASQA-----------PSTPIRKNSRNR 216
VFRFDFKDW LM ++V G ELMP RS+ ASQA +TPI+K SRN
Sbjct: 285 VFRFDFKDWKLMMDLVPAGEELMPHRDRSKGLNASQAGLAPNDYQDTLHATPIKKFSRNC 344

Query: 215 GRTSSEPCELTIELGAGEDDSEGQADNDDDASARSKRPM 99
G E +L ED D D A R KR +
Sbjct: 345 GLVIQE------QLVVKED-----PDTGDAAGRRCKRKL 372


>tr|Q9C689|Q9C689_ARATH Putative uncharacterized protein F23H24.4
(Putative uncharacterized protein At1g51130)
OS=Arabidopsis thaliana GN=At1g51130 PE=2 SV=1
Length = 403

Score = 87.8 bits (216), Expect = 3e-16
Identities = 63/165 (38%), Positives = 77/165 (46%), Gaps = 16/165 (9%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITI-QDGKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQF 357
+ TVEN+F+LSFL KDGR +I + + G F R AP A V +V+ F
Sbjct: 258 AQTVENLFALSFLAKDGRVEIIVDKSGSHFAMPRNAPDA--------NVVMSGEVIYNHF 309

Query: 356 VFRFDFKDWILMKEMVEQGAELMPKRSQQAMASQAP---------------STPIRKNSR 222
VFR DFKDW LM EMV G ELMP R +S P +TPIRK SR
Sbjct: 310 VFRLDFKDWKLMSEMVPLGEELMPHRQTAVASSSCPAASAPASADFTQDTQTTPIRKLSR 369

Query: 221 NRGRTSSEPCELTIELGAGEDDSEGQADNDDDASARSKRPMKRRM 87
NRG E E +E D D ++R KRR+
Sbjct: 370 NRGLVVQE--ETVVE------------DTPDKEGDGTRRRCKRRL 400


>tr|B8AJA9|B8AJA9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_06217 PE=4 SV=1
Length = 360

Score = 85.5 bits (210), Expect = 2e-15
Identities = 53/120 (44%), Positives = 67/120 (55%), Gaps = 13/120 (10%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQDGKQFVAF-RYAPTAAERAGRPQGVEEQQQVVNTQF 357
+ TVEN+F+LSFLVKDGR I I D + + R AP A+ A +V + F
Sbjct: 217 AQTVENVFALSFLVKDGRVAINIDDNGHHIVYPRNAPAASAIASG--------EVSYSHF 268

Query: 356 VFRFDFKDWILMKEMVEQGAELMPKRSQQAMASQ------------APSTPIRKNSRNRG 213
VFRFDFKDW LM+E+V G ELMP R+ + + A TPIRK +RNRG
Sbjct: 269 VFRFDFKDWKLMQEVVPDGEELMPHRNPENIPCAEDHDQADPPELCAQRTPIRKLTRNRG 328


>tr|Q7EXY7|Q7EXY7_ORYSJ Os08g0510900 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0016N23.127 PE=4 SV=1
Length = 397

Score = 81.3 bits (199), Expect = 3e-14
Identities = 45/86 (52%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQD-GKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQF 357
+ TVENIF+LSFLVKDGR +I + D G FV R AP A R +V+N+Q+
Sbjct: 253 AQTVENIFALSFLVKDGRVEIDVDDKGNHFVVPRNAPAAELITSR--------EVINSQY 304

Query: 356 VFRFDFKDWILMKEMVEQGAELMPKR 279
VFRFD KDW +M+ +VE G ELMP R
Sbjct: 305 VFRFDTKDWKIMEGVVEPGDELMPHR 330


>tr|B8BCB8|B8BCB8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_29840 PE=4 SV=1
Length = 396

Score = 81.3 bits (199), Expect = 3e-14
Identities = 45/86 (52%), Positives = 56/86 (65%), Gaps = 1/86 (1%)
Frame = -3

Query: 533 SHTVENIFSLSFLVKDGRAQITIQD-GKQFVAFRYAPTAAERAGRPQGVEEQQQVVNTQF 357
+ TVENIF+LSFLVKDGR +I + D G FV R AP A R +V+N+Q+
Sbjct: 252 AQTVENIFALSFLVKDGRVEIDVDDKGNHFVVPRNAPAAELITSR--------EVINSQY 303

Query: 356 VFRFDFKDWILMKEMVEQGAELMPKR 279
VFRFD KDW +M+ +VE G ELMP R
Sbjct: 304 VFRFDTKDWKIMEGVVEPGDELMPHR 329