BP912703
Clone id YMU001_000021_H09
Library
Length 493
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000021_H09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AAGTGGAAGAGTATTGCACAATTCTTGTGCTTTTAATAATAAACCAAATTCCACATACAT
AGACACTAATGCGCTGCCAACAAAGTTGTCTACATGTAAAACCCCTGTTCGATCAATGGC
AGCATGTACCTTGCAGCCTCTTTCCACATCCTTGAGCTTGATACATGCGTTAATTAAATT
AACCAAGGTAAAGCCATTCGGCTGGAATAAGTCATCTTGCATTGCTTCATACAAAGTAAG
GGCATGCCCAAGCTCTCCATTTTCAACATAGCCATTGATAAGAGAACTCCAAGAAGACTC
ATCCTTGCACAGCAAACTGTCAAAAACCTTCTGAGCCAAATGCATTCTTCCAATCTCCAC
AAACAAAGAGACCATACATGTTCCCAACGATGAATGAGAATGCAGCCCATTATTGCTTGC
ATATGAATGCAAGCGGAGGGCGACAATGGCATCTTTTGCCTTTGAGCATGTGTGGAGTAC
CTGCAGGTAATAT
■■Homology search results ■■ -
sp_hit_id O81767
Definition sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protein At4g33990 OS=Arabidopsis thaliana
Align length 161
Score (bit) 90.9
E-value 3.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912703|Adiantum capillus-veneris mRNA, clone:
YMU001_000021_H09.
(493 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protei... 91 3e-18
sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 86 7e-17
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 86 9e-17
sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protei... 84 3e-16
sp|Q9SS60|PP210_ARATH Pentatricopeptide repeat-containing protei... 82 1e-15
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 82 1e-15
sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protei... 81 2e-15
sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protei... 80 4e-15
sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protei... 80 4e-15
sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containi... 80 4e-15
sp|Q683I9|PP295_ARATH Pentatricopeptide repeat-containing protei... 80 7e-15
sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protei... 79 9e-15
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 79 9e-15
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 79 1e-14
sp|Q9C507|PP111_ARATH Putative pentatricopeptide repeat-containi... 79 1e-14
sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protei... 78 2e-14
sp|Q9FJY9|PP448_ARATH Pentatricopeptide repeat-containing protei... 78 2e-14
sp|O49399|PP321_ARATH Pentatricopeptide repeat-containing protei... 78 2e-14
sp|Q9LJR6|PP253_ARATH Putative pentatricopeptide repeat-containi... 78 2e-14
sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 78 2e-14
sp|Q9CA56|PP121_ARATH Pentatricopeptide repeat-containing protei... 78 2e-14
sp|Q9C866|PPR65_ARATH Pentatricopeptide repeat-containing protei... 77 3e-14
sp|Q9LR69|PPR8_ARATH Pentatricopeptide repeat-containing protein... 77 4e-14
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 77 6e-14
sp|Q9LSL8|PP446_ARATH Pentatricopeptide repeat-containing protei... 76 7e-14
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 76 7e-14
sp|Q9SJG6|PP200_ARATH Pentatricopeptide repeat-containing protei... 76 7e-14
sp|Q9SX45|PPR75_ARATH Pentatricopeptide repeat-containing protei... 76 1e-13
sp|Q1PFQ9|PPR62_ARATH Pentatricopeptide repeat-containing protei... 76 1e-13
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 76 1e-13

>sp|O81767|PP348_ARATH Pentatricopeptide repeat-containing protein
At4g33990 OS=Arabidopsis thaliana GN=EMB2758 PE=2 SV=2
Length = 823

Score = 90.9 bits (224), Expect = 3e-18
Identities = 51/161 (31%), Positives = 87/161 (54%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ +L C++A D + +HSY+ +GL S + ++ L+ E GR+ QKVFD +
Sbjct: 251 VSLLSACTEAGDFNRGVTIHSYSIKHGLESELFVSNKLIDLYAEFGRLRDCQKVFDRMYV 310

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
+D SW+S+I Y N + A++L++ M+ QP+ TL++L + +L D+ V
Sbjct: 311 RDLISWNSIIKAYELNEQPLRAISLFQEMRLSRIQPDCLTLISLASILSQLGDIRACRSV 370

Query: 126 HAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
R G D +G+A+V MY + GL+ A+ + N LP
Sbjct: 371 QGFTLRKGWFLEDITIGNAVVVMYAKLGLVDSARAVFNWLP 411



Score = 67.4 bits (163), Expect = 3e-11
Identities = 39/130 (30%), Positives = 74/130 (56%), Gaps = 1/130 (0%)
Frame = -2

Query: 390 SLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGELGHALTLYEAMQDD 211
++G +V ++ ++G + A+ VF+ L D SW+++I+GY +NG A+ +Y M+++
Sbjct: 385 TIGNAVVVMYAKLGLVDSARAVFNWLPNTDVISWNTIISGYAQNGFASEAIEMYNIMEEE 444

Query: 210 -LFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFGLLL 34
N T V+++ AC + + +G K+H + + G L++D FV ++L MY + G L
Sbjct: 445 GEIAANQGTWVSVLPACSQAGALRQGMKLHGRLLKNG-LYLDVFVVTSLADMYGKCGRLE 503

Query: 33 KAQELCNTLP 4
A L +P
Sbjct: 504 DALSLFYQIP 513



Score = 65.9 bits (159), Expect = 1e-10
Identities = 43/154 (27%), Positives = 77/154 (50%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
VL C + I ++H A G + ++ L+ + A+ +FD + +D
Sbjct: 159 VLKAC---RTVIDGNKIHCLALKFGFMWDVYVAASLIHLYSRYKAVGNARILFDEMPVRD 215

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHA 121
SW+++I+GY ++G ALTL + L + T+V+L++AC + D RG +H+
Sbjct: 216 MGSWNAMISGYCQSGNAKEALTL----SNGLRAMDSVTVVSLLSACTEAGDFNRGVTIHS 271

Query: 120 AIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQEL 19
+ G L + FV + L+ +Y EFG L Q++
Sbjct: 272 YSIKHG-LESELFVSNKLIDLYAEFGRLRDCQKV 304



Score = 50.1 bits (118), Expect = 6e-06
Identities = 31/118 (26%), Positives = 59/118 (50%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
++ VL CS+A ++LH NGL+ + T + ++ + GR+ A +F +
Sbjct: 454 WVSVLPACSQAGALRQGMKLHGRLLKNGLYLDVFVVTSLADMYGKCGRLEDALSLFYQIP 513

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERG 136
+ W++LI + +G A+ L++ M D+ +P+ T V L++AC V+ G
Sbjct: 514 RVNSVPWNTLIACHGFHGHGEKAVMLFKEMLDEGVKPDHITFVTLLSACSHSGLVDEG 571



Score = 45.4 bits (106), Expect = 1e-04
Identities = 30/126 (23%), Positives = 63/126 (50%), Gaps = 1/126 (0%)
Frame = -2

Query: 375 MVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGELGHALTLYEA-MQDDLFQP 199
+V+L+ +G + LA+ FD + +D +W+ +I+GY G + + M P
Sbjct: 92 LVNLYCYLGNVALARHTFDHIQNRDVYAWNLMISGYGRAGNSSEVIRCFSLFMLSSGLTP 151

Query: 198 NGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQEL 19
+ T +++ AC + V G K+H + G + D +V ++L+ +Y + + A+ L
Sbjct: 152 DYRTFPSVLKAC---RTVIDGNKIHCLALKFGFMW-DVYVAASLIHLYSRYKAVGNARIL 207

Query: 18 CNTLPL 1
+ +P+
Sbjct: 208 FDEMPV 213


>sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containing
protein At3g23330 OS=Arabidopsis thaliana GN=PCMP-H32
PE=3 SV=1
Length = 715

Score = 86.3 bits (212), Expect = 7e-17
Identities = 48/154 (31%), Positives = 80/154 (51%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
VL S+ D I +H Y G+ S +G+ +V ++ + R+ +++VF L C+D
Sbjct: 248 VLPIFSEYVDVIKGKEIHGYVIRKGIDSDVYIGSSLVDMYAKSARIEDSERVFSRLYCRD 307

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHA 121
SW+SL+ GYV+NG AL L+ M +P ++I AC L + G ++H
Sbjct: 308 GISWNSLVAGYVQNGRYNEALRLFRQMVTAKVKPGAVAFSSVIPACAHLATLHLGKQLHG 367

Query: 120 AIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQEL 19
+ R G + F+ SALV MY + G + A+++
Sbjct: 368 YVLRGG-FGSNIFIASALVDMYSKCGNIKAARKI 400



Score = 61.2 bits (147), Expect = 2e-09
Identities = 29/109 (26%), Positives = 57/109 (52%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
+ V+ C+ + +LH Y G S+ + + +V ++ + G + A+K+FD +
Sbjct: 346 FSSVIPACAHLATLHLGKQLHGYVLRGGFGSNIFIASALVDMYSKCGNIKAARKIFDRMN 405

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINAC 163
DE SW+++I G+ +G A++L+E M+ +PN V ++ AC
Sbjct: 406 VLDEVSWTAIIMGHALHGHGHEAVSLFEEMKRQGVKPNQVAFVAVLTAC 454



Score = 53.9 bits (128), Expect = 4e-07
Identities = 40/147 (27%), Positives = 73/147 (49%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
Y ++L SK V + SN+G TC++ ++ R +VF+ +
Sbjct: 150 YAKLLGMGSKISVGNVFDEMPQRTSNSG-DEDVKAETCIMPFGIDSVR-----RVFEVMP 203

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
KD S++++I GY ++G AL + M +P+ FTL +++ + DV +G +
Sbjct: 204 RKDVVSYNTIIAGYAQSGMYEDALRMVREMGTTDLKPDSFTLSSVLPIFSEYVDVIKGKE 263

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVE 49
+H + R G+ D ++GS+LV MY +
Sbjct: 264 IHGYVIRKGI-DSDVYIGSSLVDMYAK 289


>sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protein
At2g13600 OS=Arabidopsis thaliana GN=PCMP-E76 PE=2 SV=1
Length = 697

Score = 85.9 bits (211), Expect = 9e-17
Identities = 44/163 (26%), Positives = 90/163 (55%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
+ VL CS D +++HS + + S +G+ +V ++ + G ++ AQ+VFD +
Sbjct: 155 FASVLSACSGLNDMNKGVQVHSLIAKSPFLSDVYIGSALVDMYSKCGNVNDAQRVFDEMG 214

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
++ SW+SLI + +NG AL +++ M + +P+ TL ++I+AC L ++ G +
Sbjct: 215 DRNVVSWNSLITCFEQNGPAVEALDVFQMMLESRVEPDEVTLASVISACASLSAIKVGQE 274

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLPL 1
VH + + L D + +A V MY + + +A+ + +++P+
Sbjct: 275 VHGRVVKNDKLRNDIILSNAFVDMYAKCSRIKEARFIFDSMPI 317



Score = 66.2 bits (160), Expect = 8e-11
Identities = 34/119 (28%), Positives = 70/119 (58%)
Frame = -2

Query: 375 MVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPN 196
+V+ ++G + A +F S+ +D+ +W+S+++G+ ++ AL + M + F N
Sbjct: 92 VVTGLTKLGFLDEADSLFRSMPERDQCTWNSMVSGFAQHDRCEEALCYFAMMHKEGFVLN 151

Query: 195 GFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQEL 19
++ ++++AC L D+ +G +VH+ I ++ L D ++GSALV MY + G + AQ +
Sbjct: 152 EYSFASVLSACSGLNDMNKGVQVHSLIAKSPFLS-DVYIGSALVDMYSKCGNVNDAQRV 209



Score = 62.0 bits (149), Expect = 1e-09
Identities = 34/118 (28%), Positives = 62/118 (52%), Gaps = 5/118 (4%)
Frame = -2

Query: 381 TCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQ 202
T M+S + A+ +F + ++ SW++LI GY +NGE AL+L+ ++ +
Sbjct: 324 TSMISGYAMAASTKAARLMFTKMAERNVVSWNALIAGYTQNGENEEALSLFCLLKRESVC 383

Query: 201 PNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVL-----HVDNFVGSALVSMYVEFG 43
P ++ N++ AC L ++ G + H + + G D FVG++L+ MYV+ G
Sbjct: 384 PTHYSFANILKACADLAELHLGMQAHVHVLKHGFKFQSGEEDDIFVGNSLIDMYVKCG 441



Score = 56.6 bits (135), Expect = 6e-08
Identities = 37/171 (21%), Positives = 84/171 (49%), Gaps = 8/171 (4%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSS------LGTCMVSLFVEIGRMHLAQK 328
+ +L C+ + + ++ H + +G S +G ++ ++V+ G +
Sbjct: 389 FANILKACADLAELHLGMQAHVHVLKHGFKFQSGEEDDIFVGNSLIDMYVKCGCVEEGYL 448

Query: 327 VFDSLLCKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKD 148
VF ++ +D SW+++I G+ +NG AL L+ M + +P+ T++ +++AC
Sbjct: 449 VFRKMMERDCVSWNAMIIGFAQNGYGNEALELFREMLESGEKPDHITMIGVLSACGHAGF 508

Query: 147 VERGCKVHAAIDRT-GVLHV-DNFVGSALVSMYVEFGLLLKAQELCNTLPL 1
VE G +++ R GV + D++ + +V + G L +A+ + +P+
Sbjct: 509 VEEGRHYFSSMTRDFGVAPLRDHY--TCMVDLLGRAGFLEEAKSMIEEMPM 557


>sp|O64705|PP184_ARATH Pentatricopeptide repeat-containing protein
At2g34400 OS=Arabidopsis thaliana GN=PCMP-E23 PE=2 SV=2
Length = 621

Score = 84.3 bits (207), Expect = 3e-16
Identities = 48/161 (29%), Positives = 89/161 (55%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
Y V C+K ++ V +HS GL + ++ ++ + G++ A+K+FD +
Sbjct: 135 YNFVFIACAKLEEIGVGRSVHSSLFKVGLERDVHINHSLIMMYAKCGQVGYARKLFDEIT 194

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
+D SW+S+I+GY E G A+ L+ M+++ F+P+ TLV+++ AC L D+ G +
Sbjct: 195 ERDTVSWNSMISGYSEAGYAKDAMDLFRKMEEEGFEPDERTLVSMLGACSHLGDLRTG-R 253

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTL 7
+ + T + + F+GS L+SMY + G L A+ + N +
Sbjct: 254 LLEEMAITKKIGLSTFLGSKLISMYGKCGDLDSARRVFNQM 294



Score = 66.6 bits (161), Expect = 6e-11
Identities = 39/162 (24%), Positives = 81/162 (50%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ +L CS D L A + + LG+ ++S++ + G + A++VF+ ++
Sbjct: 237 VSMLGACSHLGDLRTGRLLEEMAITKKIGLSTFLGSKLISMYGKCGDLDSARRVFNQMIK 296

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
KD +W+++I Y +NG+ A L+ M+ P+ TL +++AC + +E G ++
Sbjct: 297 KDRVAWTAMITVYSQNGKSSEAFKLFFEMEKTGVSPDAGTLSTVLSACGSVGALELGKQI 356

Query: 126 HAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLPL 1
+ H + +V + LV MY + G + +A + +P+
Sbjct: 357 ETHASELSLQH-NIYVATGLVDMYGKCGRVEEALRVFEAMPV 397



Score = 62.4 bits (150), Expect = 1e-09
Identities = 37/161 (22%), Positives = 80/161 (49%), Gaps = 2/161 (1%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
VL C + ++ ++AS L + + T +V ++ + GR+ A +VF+++ K+
Sbjct: 340 VLSACGSVGALELGKQIETHASELSLQHNIYVATGLVDMYGKCGRVEEALRVFEAMPVKN 399

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK-VH 124
E++W+++I Y G AL L++ M P+ T + +++AC+ V +GC+ H
Sbjct: 400 EATWNAMITAYAHQGHAKEALLLFDRMS---VPPSDITFIGVLSACVHAGLVHQGCRYFH 456

Query: 123 AAIDRTGVL-HVDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
G++ ++++ ++ + G+L +A E P
Sbjct: 457 EMSSMFGLVPKIEHYTN--IIDLLSRAGMLDEAWEFMERFP 495



Score = 42.7 bits (99), Expect = 0.001
Identities = 31/115 (26%), Positives = 59/115 (51%), Gaps = 1/115 (0%)
Frame = -2

Query: 360 VEIGRMHLAQKVFDSLLCKDESSWSSLINGYVEN-GELGHALTLYEAMQDDLFQPNGFTL 184
VE+G + + +F + S++ +I G + AL+LY M+ +P+ FT
Sbjct: 76 VELGDFNYSSFLFSVTEEPNHYSFNYMIRGLTNTWNDHEAALSLYRRMKFSGLKPDKFTY 135

Query: 183 VNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQEL 19
+ AC KL+++ G VH+++ + G L D + +L+ MY + G + A++L
Sbjct: 136 NFVFIACAKLEEIGVGRSVHSSLFKVG-LERDVHINHSLIMMYAKCGQVGYARKL 189


>sp|Q9SS60|PP210_ARATH Pentatricopeptide repeat-containing protein
At3g03580 OS=Arabidopsis thaliana GN=PCMP-H23 PE=2 SV=1
Length = 882

Score = 82.4 bits (202), Expect = 1e-15
Identities = 44/146 (30%), Positives = 84/146 (57%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
VL C +D +A +++Y G S++ ++ ++ + G M A+ VF+S+ CKD
Sbjct: 313 VLRACGHLRDLSLAKYIYNYMLKAGFVLESTVRNILIDVYAKCGDMITARDVFNSMECKD 372

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHA 121
SW+S+I+GY+++G+L A+ L++ M Q + T + LI+ +L D++ G +H+
Sbjct: 373 TVSWNSIISGYIQSGDLMEAMKLFKMMMIMEEQADHITYLMLISVSTRLADLKFGKGLHS 432

Query: 120 AIDRTGVLHVDNFVGSALVSMYVEFG 43
++G+ +D V +AL+ MY + G
Sbjct: 433 NGIKSGIC-IDLSVSNALIDMYAKCG 457



Score = 70.1 bits (170), Expect = 5e-12
Identities = 42/145 (28%), Positives = 79/145 (54%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
V+ C+ DA + ++ + G S +G +V ++ +G + A++VFD + +D
Sbjct: 112 VIKACAGLFDAEMGDLVYEQILDMGFESDLFVGNALVDMYSRMGLLTRARQVFDEMPVRD 171

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHA 121
SW+SLI+GY +G AL +Y +++ P+ FT+ +++ A L V++G +H
Sbjct: 172 LVSWNSLISGYSSHGYYEEALEIYHELKNSWIVPDSFTVSSVLPAFGNLLVVKQGQGLHG 231

Query: 120 AIDRTGVLHVDNFVGSALVSMYVEF 46
++GV V V + LV+MY++F
Sbjct: 232 FALKSGVNSV-VVVNNGLVAMYLKF 255



Score = 64.3 bits (155), Expect = 3e-10
Identities = 42/146 (28%), Positives = 71/146 (48%), Gaps = 1/146 (0%)
Frame = -2

Query: 435 RLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL-CKDESSWSSLINGYVEN 259
R+H+ + GL S ++ + + VF + K+ W+S+I + +N
Sbjct: 25 RIHALVISLGLDSSDFFSGKLIDKYSHFREPASSLSVFRRVSPAKNVYLWNSIIRAFSKN 84

Query: 258 GELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFV 79
G AL Y +++ P+ +T ++I AC L D E G V+ I G D FV
Sbjct: 85 GLFPEALEFYGKLRESKVSPDKYTFPSVIKACAGLFDAEMGDLVYEQILDMG-FESDLFV 143

Query: 78 GSALVSMYVEFGLLLKAQELCNTLPL 1
G+ALV MY GLL +A+++ + +P+
Sbjct: 144 GNALVDMYSRMGLLTRARQVFDEMPV 169



Score = 55.1 bits (131), Expect = 2e-07
Identities = 31/142 (21%), Positives = 84/142 (59%)
Frame = -2

Query: 432 LHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGE 253
LH +A +G++S + +V+++++ R A++VFD + +D S++++I GY++
Sbjct: 229 LHGFALKSGVNSVVVVNNGLVAMYLKFRRPTDARRVFDEMDVRDSVSYNTMICGYLKLEM 288

Query: 252 LGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGS 73
+ ++ ++ D F+P+ T+ +++ AC L+D+ ++ + + G + +++ V +
Sbjct: 289 VEESVRMFLENLDQ-FKPDLLTVSSVLRACGHLRDLSLAKYIYNYMLKAGFV-LESTVRN 346

Query: 72 ALVSMYVEFGLLLKAQELCNTL 7
L+ +Y + G ++ A+++ N++
Sbjct: 347 ILIDVYAKCGDMITARDVFNSM 368



Score = 54.3 bits (129), Expect = 3e-07
Identities = 34/151 (22%), Positives = 69/151 (45%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
YL ++ ++ D LHS +G+ S+ ++ ++ + G + + K+F S+
Sbjct: 411 YLMLISVSTRLADLKFGKGLHSNGIKSGICIDLSVSNALIDMYAKCGEVGDSLKIFSSMG 470

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
D +W+++I+ V G+ L + M+ P+ T + + C L G +
Sbjct: 471 TGDTVTWNTVISACVRFGDFATGLQVTTQMRKSEVVPDMATFLVTLPMCASLAAKRLGKE 530

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLL 37
+H + R G + +G+AL+ MY + G L
Sbjct: 531 IHCCLLRFG-YESELQIGNALIEMYSKCGCL 560



Score = 45.4 bits (106), Expect = 1e-04
Identities = 34/169 (20%), Positives = 70/169 (41%), Gaps = 6/169 (3%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
+L L C+ + +H G S +G ++ ++ + G + + +VF+ +
Sbjct: 512 FLVTLPMCASLAAKRLGKEIHCCLLRFGYESELQIGNALIEMYSKCGCLENSSRVFERMS 571

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERG-- 136
+D +W+ +I Y GE AL + M+ P+ + +I AC V+ G
Sbjct: 572 RRDVVTWTGMIYAYGMYGEGEKALETFADMEKSGIVPDSVVFIAIIYACSHSGLVDEGLA 631

Query: 135 ----CKVHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLPL 1
K H ID ++++ + +V + + KA+E +P+
Sbjct: 632 CFEKMKTHYKIDPM----IEHY--ACVVDLLSRSQKISKAEEFIQAMPI 674


>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein
At3g09040, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E88 PE=2 SV=1
Length = 1028

Score = 82.0 bits (201), Expect = 1e-15
Identities = 46/142 (32%), Positives = 82/142 (57%)
Frame = -2

Query: 444 VALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYV 265
+ L +H+ A GL S+ +G+ +VS++ + +M A KVF++L K++ W+++I GY
Sbjct: 345 LGLVVHAEAIKLGLASNIYVGSSLVSMYSKCEKMEAAAKVFEALEEKNDVFWNAMIRGYA 404

Query: 264 ENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDN 85
NGE + L+ M+ + + FT +L++ C D+E G + H+ I + L +
Sbjct: 405 HNGESHKVMELFMDMKSSGYNIDDFTFTSLLSTCAASHDLEMGSQFHSIIIKK-KLAKNL 463

Query: 84 FVGSALVSMYVEFGLLLKAQEL 19
FVG+ALV MY + G L A+++
Sbjct: 464 FVGNALVDMYAKCGALEDARQI 485



Score = 72.8 bits (177), Expect = 8e-13
Identities = 39/162 (24%), Positives = 84/162 (51%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
+ +L TC+ + D + + HS L + +G +V ++ + G + A+++F+ +
Sbjct: 431 FTSLLSTCAASHDLEMGSQFHSIIIKKKLAKNLFVGNALVDMYAKCGALEDARQIFERMC 490

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
+D +W+++I YV++ A L++ M +G L + + AC + + +G +
Sbjct: 491 DRDNVTWNTIIGSYVQDENESEAFDLFKRMNLCGIVSDGACLASTLKACTHVHGLYQGKQ 550

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
VH + G L D GS+L+ MY + G++ A+++ ++LP
Sbjct: 551 VHCLSVKCG-LDRDLHTGSSLIDMYSKCGIIKDARKVFSSLP 591



Score = 58.2 bits (139), Expect = 2e-08
Identities = 30/109 (27%), Positives = 59/109 (54%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
VL TC++ + ++H GL +S G +V ++ + R+ A++VF+ ++ +
Sbjct: 166 VLSTCARETNVEFGRQIHCSMIKMGLERNSYCGGALVDMYAKCDRISDARRVFEWIVDPN 225

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKL 154
W+ L +GYV+ G A+ ++E M+D+ +P+ V +IN I+L
Sbjct: 226 TVCWTCLFSGYVKAGLPEEAVLVFERMRDEGHRPDHLAFVTVINTYIRL 274



Score = 56.6 bits (135), Expect = 6e-08
Identities = 36/142 (25%), Positives = 66/142 (46%)
Frame = -2

Query: 477 LHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDE 298
L C+ ++H + GL G+ ++ ++ + G + A+KVF SL
Sbjct: 536 LKACTHVHGLYQGKQVHCLSVKCGLDRDLHTGSSLIDMYSKCGIIKDARKVFSSLPEWSV 595

Query: 297 SSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAA 118
S ++LI GY +N L A+ L++ M P+ T ++ AC K + + G + H
Sbjct: 596 VSMNALIAGYSQNN-LEEAVVLFQEMLTRGVNPSEITFATIVEACHKPESLTLGTQFHGQ 654

Query: 117 IDRTGVLHVDNFVGSALVSMYV 52
I + G ++G +L+ MY+
Sbjct: 655 ITKRGFSSEGEYLGISLLGMYM 676



Score = 55.8 bits (133), Expect = 1e-07
Identities = 39/159 (24%), Positives = 73/159 (45%), Gaps = 3/159 (1%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
++ VL CS +HS + ++ ++ + G M + +VFD +
Sbjct: 735 FVTVLRVCSVLSSLREGRAIHSLIFHLAHDLDELTSNTLIDMYAKCGDMKGSSQVFDEMR 794

Query: 309 CKDES-SWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGC 133
+ SW+SLINGY +NG AL ++++M+ P+ T + ++ AC V G
Sbjct: 795 RRSNVVSWNSLINGYAKNGYAEDALKIFDSMRQSHIMPDEITFLGVLTACSHAGKVSDGR 854

Query: 132 KV-HAAIDRTGV-LHVDNFVGSALVSMYVEFGLLLKAQE 22
K+ I + G+ VD+ + +V + +G L +A +
Sbjct: 855 KIFEMMIGQYGIEARVDHV--ACMVDLLGRWGYLQEADD 891



Score = 54.3 bits (129), Expect = 3e-07
Identities = 34/151 (22%), Positives = 65/151 (43%), Gaps = 2/151 (1%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSS-LGTCMVSLFVEIGRMHLAQKVFDSL 313
+ ++ C K + + + H + G S LG ++ +++ M A +F L
Sbjct: 632 FATIVEACHKPESLTLGTQFHGQITKRGFSSEGEYLGISLLGMYMNSRGMTEACALFSEL 691

Query: 312 LC-KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERG 136
K W+ +++G+ +NG AL Y+ M+ D P+ T V ++ C L + G
Sbjct: 692 SSPKSIVLWTGMMSGHSQNGFYEEALKFYKEMRHDGVLPDQATFVTVLRVCSVLSSLREG 751

Query: 135 CKVHAAIDRTGVLHVDNFVGSALVSMYVEFG 43
+H+ I +D + L+ MY + G
Sbjct: 752 RAIHSLIFHL-AHDLDELTSNTLIDMYAKCG 781


>sp|Q9SUH6|PP341_ARATH Pentatricopeptide repeat-containing protein
At4g30700 OS=Arabidopsis thaliana GN=DYW9 PE=2 SV=1
Length = 792

Score = 81.3 bits (199), Expect = 2e-15
Identities = 41/138 (29%), Positives = 77/138 (55%)
Frame = -2

Query: 432 LHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGE 253
+H Y + SH+S+ T + +++ ++ + A+K+FD K SW+++I+GY +NG
Sbjct: 341 IHGYCLKSNFLSHASVSTALTTVYSKLNEIESARKLFDESPEKSLPSWNAMISGYTQNGL 400

Query: 252 LGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGS 73
A++L+ MQ F PN T+ +++AC +L + G VH + R+ +V +
Sbjct: 401 TEDAISLFREMQKSEFSPNPVTITCILSACAQLGALSLGKWVHDLV-RSTDFESSIYVST 459

Query: 72 ALVSMYVEFGLLLKAQEL 19
AL+ MY + G + +A+ L
Sbjct: 460 ALIGMYAKCGSIAEARRL 477



Score = 58.2 bits (139), Expect = 2e-08
Identities = 36/150 (24%), Positives = 79/150 (52%), Gaps = 1/150 (0%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
Y + S +D +H A +G S LG+ +V ++ + R+ A+KVFD +
Sbjct: 122 YAFAISAASGFRDDRAGRVIHGQAVVDGCDSELLLGSNIVKMYFKFWRVEDARKVFDRMP 181

Query: 309 CKDESSWSSLINGYVENGELGHALTLY-EAMQDDLFQPNGFTLVNLINACIKLKDVERGC 133
KD W+++I+GY +N ++ ++ + + + + + TL++++ A +L+++ G
Sbjct: 182 EKDTILWNTMISGYRKNEMYVESIQVFRDLINESCTRLDTTTLLDILPAVAELQELRLGM 241

Query: 132 KVHAAIDRTGVLHVDNFVGSALVSMYVEFG 43
++H+ +TG D +V + +S+Y + G
Sbjct: 242 QIHSLATKTGCYSHD-YVLTGFISLYSKCG 270



Score = 52.8 bits (125), Expect = 9e-07
Identities = 26/105 (24%), Positives = 59/105 (56%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
L +L ++ ++ + +++HS A+ G +SH + T +SL+ + G++ + +F
Sbjct: 225 LDILPAVAELQELRLGMQIHSLATKTGCYSHDYVLTGFISLYSKCGKIKMGSALFREFRK 284

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLI 172
D +++++I+GY NGE +L+L++ + + TLV+L+
Sbjct: 285 PDIVAYNAMIHGYTSNGETELSLSLFKELMLSGARLRSSTLVSLV 329



Score = 49.7 bits (117), Expect = 7e-06
Identities = 28/127 (22%), Positives = 64/127 (50%), Gaps = 1/127 (0%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
+L C++ + +H + S + T ++ ++ + G + A+++FD + K+
Sbjct: 426 ILSACAQLGALSLGKWVHDLVRSTDFESSIYVSTALIGMYAKCGSIAEARRLFDLMTKKN 485

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV-H 124
E +W+++I+GY +G+ AL ++ M + P T + ++ AC V+ G ++ +
Sbjct: 486 EVTWNTMISGYGLHGQGQEALNIFYEMLNSGITPTPVTFLCVLYACSHAGLVKEGDEIFN 545

Query: 123 AAIDRTG 103
+ I R G
Sbjct: 546 SMIHRYG 552


>sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protein
At5g04780 OS=Arabidopsis thaliana GN=PCMP-H16 PE=2 SV=2
Length = 635

Score = 80.5 bits (197), Expect = 4e-15
Identities = 49/148 (33%), Positives = 78/148 (52%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
VL C DA+ +LH + + + +GT ++ L+ + G + A +VF+S+ K
Sbjct: 168 VLSACGVNCDALECKKLHCLSVKTCIDLNLYVGTALLDLYAKCGMIKDAVQVFESMQDKS 227

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHA 121
+WSS++ GYV+N AL LY Q + N FTL ++I AC L + G ++HA
Sbjct: 228 SVTWSSMVAGYVQNKNYEEALLLYRRAQRMSLEQNQFTLSSVICACSNLAALIEGKQMHA 287

Query: 120 AIDRTGVLHVDNFVGSALVSMYVEFGLL 37
I ++G + FV S+ V MY + G L
Sbjct: 288 VICKSG-FGSNVFVASSAVDMYAKCGSL 314



Score = 61.6 bits (148), Expect = 2e-09
Identities = 37/159 (23%), Positives = 84/159 (52%)
Frame = -2

Query: 483 QVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCK 304
++L C++ + A H L +L +++ + + G + LA++VFD +L +
Sbjct: 66 EILQLCARNGAVMEAKACHGKIIRIDLEGDVTLLNVLINAYSKCGFVELARQVFDGMLER 125

Query: 303 DESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVH 124
SW+++I Y N AL ++ M+++ F+ + FT+ ++++AC D K+H
Sbjct: 126 SLVSWNTMIGLYTRNRMESEALDIFLEMRNEGFKFSEFTISSVLSACGVNCDALECKKLH 185

Query: 123 AAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTL 7
+T + ++ +VG+AL+ +Y + G++ A ++ ++
Sbjct: 186 CLSVKT-CIDLNLYVGTALLDLYAKCGMIKDAVQVFESM 223



Score = 61.2 bits (147), Expect = 2e-09
Identities = 38/159 (23%), Positives = 74/159 (46%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
V+ CS I ++H+ +G S+ + + V ++ + G + + +F + K+
Sbjct: 269 VICACSNLAALIEGKQMHAVICKSGFGSNVFVASSAVDMYAKCGSLRESYIIFSEVQEKN 328

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHA 121
W+++I+G+ ++ + L+E MQ D PN T +L++ C VE G +
Sbjct: 329 LELWNTIISGFAKHARPKEVMILFEKMQQDGMHPNEVTFSSLLSVCGHTGLVEEGRRFFK 388

Query: 120 AIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
+ T L + S +V + GLL +A EL ++P
Sbjct: 389 LMRTTYGLSPNVVHYSCMVDILGRAGLLSEAYELIKSIP 427


>sp|A8MQA3|PP330_ARATH Pentatricopeptide repeat-containing protein
At4g21065 OS=Arabidopsis thaliana GN=PCMP-H28 PE=2 SV=2
Length = 595

Score = 80.5 bits (197), Expect = 4e-15
Identities = 47/141 (33%), Positives = 77/141 (54%), Gaps = 3/141 (2%)
Frame = -2

Query: 432 LHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGE 253
+HS +G S + ++ L+ G + A KVFD + KD +W+S+ING+ ENG+
Sbjct: 143 IHSVVIRSGFGSLIYVQNSLLHLYANCGDVASAYKVFDKMPEKDLVAWNSVINGFAENGK 202

Query: 252 LGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGV---LHVDNF 82
AL LY M +P+GFT+V+L++AC K+ + G +VH + + G+ LH N
Sbjct: 203 PEEALALYTEMNSKGIKPDGFTIVSLLSACAKIGALTLGKRVHVYMIKVGLTRNLHSSN- 261

Query: 81 VGSALVSMYVEFGLLLKAQEL 19
L+ +Y G + +A+ L
Sbjct: 262 ---VLLDLYARCGRVEEAKTL 279



Score = 56.2 bits (134), Expect = 8e-08
Identities = 40/165 (24%), Positives = 76/165 (46%), Gaps = 3/165 (1%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ +L C+K + R+H Y GL + ++ L+ GR+ A+ +FD ++
Sbjct: 226 VSLLSACAKIGALTLGKRVHVYMIKVGLTRNLHSSNVLLDLYARCGRVEEAKTLFDEMVD 285

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQD-DLFQPNGFTLVNLINACIKLKDVERGCK 130
K+ SW+SLI G NG A+ L++ M+ + P T V ++ AC V+ G +
Sbjct: 286 KNSVSWTSLIVGLAVNGFGKEAIELFKYMESTEGLLPCEITFVGILYACSHCGMVKEGFE 345

Query: 129 VHAAIDRTGVL--HVDNFVGSALVSMYVEFGLLLKAQELCNTLPL 1
+ + +++F +V + G + KA E ++P+
Sbjct: 346 YFRRMREEYKIEPRIEHF--GCMVDLLARAGQVKKAYEYIKSMPM 388



Score = 49.7 bits (117), Expect = 7e-06
Identities = 40/150 (26%), Positives = 75/150 (50%), Gaps = 6/150 (4%)
Frame = -2

Query: 435 RLHSYASNNGLH-SHSSLGTCMVSLFVEIGR---MHLAQKVFDSLLCK-DESSWSSLING 271
++H+++ +G+ S + LG ++ V + M A KVF + + W++LI G
Sbjct: 35 QIHAFSIRHGVSISDAELGKHLIFYLVSLPSPPPMSYAHKVFSKIEKPINVFIWNTLIRG 94

Query: 270 YVENGELGHALTLYEAMQ-DDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLH 94
Y E G A +LY M+ L +P+ T LI A + DV G +H+ + R+G
Sbjct: 95 YAEIGNSISAFSLYREMRVSGLVEPDTHTYPFLIKAVTTMADVRLGETIHSVVIRSGFGS 154

Query: 93 VDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
+ +V ++L+ +Y G + A ++ + +P
Sbjct: 155 L-IYVQNSLLHLYANCGDVASAYKVFDKMP 183


>sp|Q9LSB8|PP235_ARATH Putative pentatricopeptide repeat-containing
protein At3g15930 OS=Arabidopsis thaliana GN=PCMP-E51
PE=3 SV=2
Length = 687

Score = 80.5 bits (197), Expect = 4e-15
Identities = 55/187 (29%), Positives = 91/187 (48%), Gaps = 31/187 (16%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYAS-----------NNGLHSHSSLG-------------- 382
L VL CSK KD + R+H Y S N ++++++ G
Sbjct: 240 LLVLSACSKVKDKDLCKRVHEYVSECKTEPSLRLENALVNAYAACGEMDIAVRIFRSMKA 299

Query: 381 ------TCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGELGHALTLYEAM 220
T +V +VE G + LA+ FD + +D SW+ +I+GY+ G +L ++ M
Sbjct: 300 RDVISWTSIVKGYVERGNLKLARTYFDQMPVRDRISWTIMIDGYLRAGCFNESLEIFREM 359

Query: 219 QDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFGL 40
Q P+ FT+V+++ AC L +E G + ID+ + + D VG+AL+ MY + G
Sbjct: 360 QSAGMIPDEFTMVSVLTACAHLGSLEIGEWIKTYIDKNKIKN-DVVVGNALIDMYFKCGC 418

Query: 39 LLKAQEL 19
KAQ++
Sbjct: 419 SEKAQKV 425



Score = 62.4 bits (150), Expect = 1e-09
Identities = 36/162 (22%), Positives = 76/162 (46%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ VL C+ + + +Y N + + +G ++ ++ + G AQKVF +
Sbjct: 372 VSVLTACAHLGSLEIGEWIKTYIDKNKIKNDVVVGNALIDMYFKCGCSEKAQKVFHDMDQ 431

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
+D+ +W++++ G NG+ A+ ++ MQD QP+ T + +++AC V++ K
Sbjct: 432 RDKFTWTAMVVGLANNGQGQEAIKVFFQMQDMSIQPDDITYLGVLSACNHSGMVDQARKF 491

Query: 126 HAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLPL 1
A + + +V M GL+ +A E+ +P+
Sbjct: 492 FAKMRSDHRIEPSLVHYGCMVDMLGRAGLVKEAYEILRKMPM 533



Score = 59.3 bits (142), Expect = 9e-09
Identities = 39/134 (29%), Positives = 67/134 (50%), Gaps = 3/134 (2%)
Frame = -2

Query: 435 RLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENG 256
+LH + GL S+ + +V ++ G M +A+ VFD +D SW+ +I+GY
Sbjct: 156 KLHCHVVKFGLGSNLYVQNALVKMYSLCGLMDMARGVFDRRCKEDVFSWNLMISGYNRMK 215

Query: 255 ELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGV---LHVDN 85
E ++ L M+ +L P TL+ +++AC K+KD + +VH + L ++N
Sbjct: 216 EYEESIELLVEMERNLVSPTSVTLLLVLSACSKVKDKDLCKRVHEYVSECKTEPSLRLEN 275

Query: 84 FVGSALVSMYVEFG 43
ALV+ Y G
Sbjct: 276 ----ALVNAYAACG 285



Score = 33.1 bits (74), Expect = 0.71
Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 2/107 (1%)
Frame = -2

Query: 351 GRMHLAQKVFDSLLCKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLI 172
G + A K+F + D W+++I G+ + G + LY M + P+ T L+
Sbjct: 82 GHVSYAYKLFVKIPEPDVVVWNNMIKGWSKVDCDGEGVRLYLNMLKEGVTPDSHTFPFLL 141

Query: 171 NACIKLKDVERGC--KVHAAIDRTGVLHVDNFVGSALVSMYVEFGLL 37
N +K C K+H + + G L + +V +ALV MY GL+
Sbjct: 142 NG-LKRDGGALACGKKLHCHVVKFG-LGSNLYVQNALVKMYSLCGLM 186


tr_hit_id A7QI67
Definition tr|A7QI67|A7QI67_VITVI Chromosome chr17 scaffold_101, whole genome shotgun sequence OS=Vitis vinifera
Align length 159
Score (bit) 102.0
E-value 1.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912703|Adiantum capillus-veneris mRNA, clone:
YMU001_000021_H09.
(493 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QI67|A7QI67_VITVI Chromosome chr17 scaffold_101, whole geno... 102 1e-20
tr|A5C5E6|A5C5E6_VITVI Putative uncharacterized protein OS=Vitis... 102 1e-20
tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella paten... 98 2e-19
tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella paten... 94 3e-18
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 92 1e-17
tr|A7R4G1|A7R4G1_VITVI Chromosome undetermined scaffold_682, who... 92 1e-17
tr|A7R352|A7R352_VITVI Chromosome undetermined scaffold_484, who... 92 1e-17
tr|Q5QNL7|Q5QNL7_ORYSJ Pentatricopeptide repeat protein-like OS=... 92 2e-17
tr|Q0JPS7|Q0JPS7_ORYSJ Os01g0205200 protein (Fragment) OS=Oryza ... 92 2e-17
tr|A2ZQG6|A2ZQG6_ORYSJ Putative uncharacterized protein OS=Oryza... 92 2e-17
tr|A7PGH4|A7PGH4_VITVI Chromosome chr17 scaffold_16, whole genom... 91 4e-17
tr|A7QN82|A7QN82_VITVI Chromosome undetermined scaffold_131, who... 90 5e-17
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 89 9e-17
tr|A9S537|A9S537_PHYPA Predicted protein OS=Physcomitrella paten... 89 9e-17
tr|A7R1A1|A7R1A1_VITVI Chromosome undetermined scaffold_342, who... 89 9e-17
tr|A5BIR2|A5BIR2_VITVI Putative uncharacterized protein OS=Vitis... 89 1e-16
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 88 2e-16
tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella paten... 88 2e-16
tr|A9T480|A9T480_PHYPA Predicted protein (Fragment) OS=Physcomit... 88 2e-16
tr|Q5W964|Q5W964_PHYPA PPR986-12 OS=Physcomitrella patens PE=2 SV=1 88 2e-16
tr|A9TNX6|A9TNX6_PHYPA Predicted protein OS=Physcomitrella paten... 88 2e-16
tr|Q2HS18|Q2HS18_MEDTR Tetratricopeptide-like helical OS=Medicag... 87 4e-16
tr|A7QIK1|A7QIK1_VITVI Chromosome chr9 scaffold_104, whole genom... 87 4e-16
tr|Q94LG3|Q94LG3_ORYSJ Putative selenium-binding protein-like OS... 87 6e-16
tr|Q10K51|Q10K51_ORYSJ Pentatricopeptide, putative (Putative unc... 87 6e-16
tr|Q0DRC7|Q0DRC7_ORYSJ Os03g0396200 protein OS=Oryza sativa subs... 87 6e-16
tr|A7QI85|A7QI85_VITVI Chromosome chr17 scaffold_101, whole geno... 87 6e-16
tr|A7PFN9|A7PFN9_VITVI Chromosome chr11 scaffold_14, whole genom... 86 7e-16
tr|A7P9K4|A7P9K4_VITVI Chromosome chr3 scaffold_8, whole genome ... 86 7e-16
tr|A5BMC7|A5BMC7_VITVI Putative uncharacterized protein OS=Vitis... 86 7e-16

>tr|A7QI67|A7QI67_VITVI Chromosome chr17 scaffold_101, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00000114001
PE=4 SV=1
Length = 633

Score = 102 bits (254), Expect = 1e-20
Identities = 53/159 (33%), Positives = 95/159 (59%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
VL C+K D + LR+ N L S+ + T M+ ++V+ G + + VFD + +D
Sbjct: 234 VLSICAKLGDLEMGLRIKKLNDNKNLGSNMIVSTAMLEMYVKCGAVDDGRLVFDHMARRD 293

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHA 121
+WS++I GY +NG AL L+E M+ +PN TLV++++AC +L VE G ++ +
Sbjct: 294 VVTWSAMIAGYAQNGRSNEALELFENMKSAQIKPNDVTLVSVLSACAQLGSVETGERIGS 353

Query: 120 AIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
++ G++ + +V SAL+ MY + G ++KA+++ + LP
Sbjct: 354 YVESRGLIS-NVYVASALLGMYSKCGNIIKARQIFDKLP 391



Score = 71.2 bits (173), Expect = 2e-11
Identities = 33/112 (29%), Positives = 65/112 (58%)
Frame = -2

Query: 378 CMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQP 199
C++S + G + A+++FD + + SW+++I+ Y +NG+ +++ MQD++ +P
Sbjct: 167 CLISAYSRSGEVLAARELFDKMRDRSIVSWNAMISCYAQNGDYHKGWIIFQRMQDEMCEP 226

Query: 198 NGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFG 43
N TL +++ C KL D+E G ++ D L + V +A++ MYV+ G
Sbjct: 227 NEITLATVLSICAKLGDLEMGLRIKKLNDNKN-LGSNMIVSTAMLEMYVKCG 277



Score = 70.9 bits (172), Expect = 3e-11
Identities = 42/157 (26%), Positives = 80/157 (50%), Gaps = 2/157 (1%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ VL C++ R+ SY + GL S+ + + ++ ++ + G + A+++FD L
Sbjct: 333 VSVLSACAQLGSVETGERIGSYVESRGLISNVYVASALLGMYSKCGNIIKARQIFDKLPQ 392

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
+D +W+S+I G NG A+ LY M++ +PN T V L+ AC VE G +
Sbjct: 393 RDNVTWNSMIMGLAINGFAEDAIALYNRMKEIEVKPNNITFVGLMTACTHAGHVELGLEF 452

Query: 126 HAAI--DRTGVLHVDNFVGSALVSMYVEFGLLLKAQE 22
++ D ++++F + +V ++ G L+ A E
Sbjct: 453 FRSMRSDHNISPNIEHF--ACIVDLFCRSGRLIDAYE 487



Score = 39.7 bits (91), Expect = 0.078
Identities = 29/122 (23%), Positives = 53/122 (43%)
Frame = -2

Query: 390 SLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGELGHALTLYEAMQDD 211
SL + + + A++VFD + D+ S I Y AL + +M +
Sbjct: 31 SLTPLFIRRLLNASFIQYARQVFDQIPHPDQGVHCSFITAYSRLSLNNEALRTFVSMHQN 90

Query: 210 LFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLK 31
+ FT+ + +C L ++ G +VH+ + R G H F +AL++ Y + L
Sbjct: 91 NVRIVCFTIPPIFKSCASLLAIDVGKQVHSLVIRYG-FHSSVFCQNALINFYAKINDLGS 149

Query: 30 AQ 25
A+
Sbjct: 150 AE 151


>tr|A5C5E6|A5C5E6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_033310 PE=4 SV=1
Length = 396

Score = 102 bits (254), Expect = 1e-20
Identities = 53/159 (33%), Positives = 94/159 (59%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
VL C+K D + LR+ N L S+ + T M+ ++V+ G + + VFD + +D
Sbjct: 12 VLSICAKLGDLEMGLRIKKLXDNKNLGSNMIVSTAMLEMYVKCGAVDDGRLVFDHMARRD 71

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHA 121
WS++I GY +NG AL L+E M+ +PN TLV++++AC +L VE G ++ +
Sbjct: 72 VVXWSAMIAGYAQNGRSNEALELFEXMKSAQIKPNDVTLVSVLSACAQLGSVETGERIGS 131

Query: 120 AIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
++ G++ + +V SAL+ MY + G ++KA+++ + LP
Sbjct: 132 YVESRGLIS-NVYVASALLGMYSKCGNIIKARQIFDKLP 169



Score = 71.2 bits (173), Expect = 2e-11
Identities = 42/157 (26%), Positives = 80/157 (50%), Gaps = 2/157 (1%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ VL C++ R+ SY + GL S+ + + ++ ++ + G + A+++FD L
Sbjct: 111 VSVLSACAQLGSVETGERIGSYVESRGLISNVYVASALLGMYSKCGNIIKARQIFDKLPQ 170

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
+D +W+S+I G NG A+ LY M++ +PN T V L+ AC VE G +
Sbjct: 171 RDNVTWNSMIMGLAINGFAEDAIALYNRMKEIEVKPNNITFVGLLTACTHAGHVELGLEF 230

Query: 126 HAAI--DRTGVLHVDNFVGSALVSMYVEFGLLLKAQE 22
++ D ++++F + +V ++ G L+ A E
Sbjct: 231 FRSMRSDHNISPNIEHF--ACIVDLFCRSGRLIDAYE 265



Score = 35.4 bits (80), Expect = 1.5
Identities = 17/54 (31%), Positives = 30/54 (55%)
Frame = -2

Query: 204 QPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFG 43
+P+ TL +++ C KL D+E G ++ D L + V +A++ MYV+ G
Sbjct: 3 EPBEITLATVLSICAKLGDLEMGLRIKKLXDNKN-LGSNMIVSTAMLEMYVKCG 55


>tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_154890 PE=4 SV=1
Length = 922

Score = 98.2 bits (243), Expect = 2e-19
Identities = 54/162 (33%), Positives = 89/162 (54%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
+ +L C+ D L+LH+Y GL +G ++S++ G + A++VFD+L
Sbjct: 256 FASILGACTNPNDLEQGLKLHAYIKQAGLEQEVLVGNALISMYARCGSLANARQVFDNLR 315

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
+ SW+++I GY E G + A L+ MQ FQP+ FT +L+ C D+ RG +
Sbjct: 316 SPNRVSWNAMIAGYGE-GFMEEAFRLFRDMQQKGFQPDRFTYASLLAICADRADLNRGKE 374

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
+H+ I RT D V +AL+SMY + G L +A+++ N +P
Sbjct: 375 LHSQIVRT-AWEADVTVATALISMYAKCGSLEEARKVFNQMP 415



Score = 95.9 bits (237), Expect = 9e-19
Identities = 47/161 (29%), Positives = 93/161 (57%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
++ +L C ++HS+ + G S ++ T +++++ + G + LA+KVF+ +
Sbjct: 155 FISILSACQTPIVLEFGEQIHSHITKAGYESDVNVSTALINMYCKCGSLELARKVFNEMR 214

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
++ SW+++I+GYV++G+ A L++ + QPN + +++ AC D+E+G K
Sbjct: 215 ERNVVSWTAMISGYVQHGDSKEAFVLFQKLIRSGTQPNKVSFASILGACTNPNDLEQGLK 274

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTL 7
+HA I + G L + VG+AL+SMY G L A+++ + L
Sbjct: 275 LHAYIKQAG-LEQEVLVGNALISMYARCGSLANARQVFDNL 314



Score = 83.2 bits (204), Expect = 6e-15
Identities = 47/157 (29%), Positives = 82/157 (52%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
Y +L C+ D LHS + ++ T ++S++ + G + A+KVF+ +
Sbjct: 356 YASLLAICADRADLNRGKELHSQIVRTAWEADVTVATALISMYAKCGSLEEARKVFNQMP 415

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
K+ SW++ I +G A +++ M+ D P+ T + L+N+C +D ERG
Sbjct: 416 EKNAVSWNAFIACCCRHGSEKEAFQVFKQMRRDDVIPDHVTFITLLNSCTSPEDFERGRY 475

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQEL 19
+H ID+ G+L +N V +AL+SMY G L A+E+
Sbjct: 476 IHGKIDQWGMLS-NNLVANALISMYGRCGKLADAREV 511



Score = 75.1 bits (183), Expect = 2e-12
Identities = 44/162 (27%), Positives = 86/162 (53%)
Frame = -2

Query: 492 YYLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSL 313
+Y + L C +AK ++H + + L ++S++ + G + A VF S+
Sbjct: 53 FYARRLQECVQAKSLAEGKKVHDHMRSAQFEPDIYLNNMLISMYSKCGSIEDANNVFQSM 112

Query: 312 LCKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGC 133
KD SW+++I+GY +G A+ L+ MQ + +PN + +++++AC +E G
Sbjct: 113 EDKDVVSWNAMISGYALHGRGQEAVDLFYQMQREGLKPNQNSFISILSACQTPIVLEFGE 172

Query: 132 KVHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTL 7
++H+ I + G D V +AL++MY + G L A+++ N +
Sbjct: 173 QIHSHITKAG-YESDVNVSTALINMYCKCGSLELARKVFNEM 213



Score = 73.2 bits (178), Expect = 6e-12
Identities = 38/154 (24%), Positives = 85/154 (55%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
++ +L++C+ +D +H G+ S++ + ++S++ G++ A++VF +
Sbjct: 457 FITLLNSCTSPEDFERGRYIHGKIDQWGMLSNNLVANALISMYGRCGKLADAREVFYRIR 516

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
+D SW+++I YV++G G A L+ + + + + +T +N++ A L+D++ G K
Sbjct: 517 RRDLGSWNAMIAAYVQHGANGSAFDLFIKYKSEGGKGDKYTFINVLRAIANLEDLDAGRK 576

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKA 28
+H +++ G L D + + L+ MY + G L A
Sbjct: 577 IHGLVEKAG-LEKDIRILTTLIKMYSKCGSLRDA 609



Score = 60.8 bits (146), Expect = 3e-08
Identities = 35/156 (22%), Positives = 73/156 (46%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
++ VL + +D ++H GL + T ++ ++ + G + A VF ++
Sbjct: 558 FINVLRAIANLEDLDAGRKIHGLVEKAGLEKDIRILTTLIKMYSKCGSLRDAYSVFKNVQ 617

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
KD W++++ Y + AL L++ M+ + P+ T +++NAC +L +E G K
Sbjct: 618 EKDVVCWNAMLAAYNHSDHGQDALKLFQQMRLEGVNPDSATYTSVLNACARLGAIEHGKK 677

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQE 22
H + + + D + +V+ LL +A+E
Sbjct: 678 FHTQL-KEAAMETDTRHYACMVAALGRASLLKEAEE 712


>tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_169414 PE=4 SV=1
Length = 703

Score = 94.0 bits (232), Expect = 3e-18
Identities = 53/161 (32%), Positives = 94/161 (58%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
Y++VL C K KD + A ++H + + ++ + ++ +++E GR+ A+ VFD+L+
Sbjct: 31 YVEVLKRCLKQKDLMAAKQVHDCIIKSRMEQNAHVMNNLLHVYIECGRLQEARCVFDALV 90

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
K +SW+++I GYVE+ A+ L+ M + QPN T + ++ AC L ++ G +
Sbjct: 91 KKSGASWNAMIAGYVEHKHAEDAMRLFREMCHEGVQPNAGTYMIILKACASLSALKWGKE 150

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTL 7
VHA I R G L D VG+AL+ MY + G + +A+ + + L
Sbjct: 151 VHACI-RHGGLESDVRVGTALLRMYGKCGSINEARRIFDNL 190



Score = 77.4 bits (189), Expect = 3e-13
Identities = 44/149 (29%), Positives = 79/149 (53%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
Y+ +L C+ +H+ + GL S +GT ++ ++ + G ++ A+++FD+L+
Sbjct: 132 YMIILKACASLSALKWGKEVHACIRHGGLESDVRVGTALLRMYGKCGSINEARRIFDNLM 191

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
D SW+ +I Y ++G A L M+ + F+PN T V+++NAC ++ +
Sbjct: 192 NHDIISWTVMIGAYAQSGNGKEAYRLMLQMEQEGFKPNAITYVSILNACASEGALKWVKR 251

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFG 43
VH G L +D VG+ALV MY + G
Sbjct: 252 VHRHALDAG-LELDVRVGTALVQMYAKSG 279



Score = 75.9 bits (185), Expect = 1e-12
Identities = 45/149 (30%), Positives = 78/149 (52%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
Y+ +L+ C+ R+H +A + GL +GT +V ++ + G + A+ VFD +
Sbjct: 233 YVSILNACASEGALKWVKRVHRHALDAGLELDVRVGTALVQMYAKSGSIDDARVVFDRMK 292

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
+D SW+ +I + E+G A L+ MQ + +P+ ++++NAC +E K
Sbjct: 293 VRDVVSWNVMIGAFAEHGRGHEAYDLFLQMQTEGCKPDAIMFLSILNACASAGALEWVKK 352

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFG 43
+H +G L VD VG+ALV MY + G
Sbjct: 353 IHRHALDSG-LEVDVRVGTALVHMYSKSG 380



Score = 61.6 bits (148), Expect = 2e-08
Identities = 37/155 (23%), Positives = 80/155 (51%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
+L +L+ C+ A ++H +A ++GL +GT +V ++ + G + A+ VFD +
Sbjct: 334 FLSILNACASAGALEWVKKIHRHALDSGLEVDVRVGTALVHMYSKSGSIDDARVVFDRMK 393

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
++ SW+++I+G ++G AL ++ M +P+ T V +++AC V+ G
Sbjct: 394 VRNVVSWNAMISGLAQHGLGQDALEVFRRMTAHGVKPDRVTFVAVLSACSHAGLVDEGRS 453

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQ 25
+ A+ + + D + +V + G L++A+
Sbjct: 454 QYLAMTQVYGIEPDVSHCNCMVDLLGRAGRLMEAK 488


>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 92.4 bits (228), Expect = 1e-17
Identities = 50/163 (30%), Positives = 88/163 (53%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLL 310
+L V+ C D ++H G S +GT + S++ + G + A++VFD +
Sbjct: 123 FLSVIKACGSQSDLQAGRKVHEDIIARGFESDVIVGTALASMYTKCGSLENARQVFDRMP 182

Query: 309 CKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCK 130
+D SW+++I GY +NG+ AL L+ MQ + +PN TLV+++ C L +E+G +
Sbjct: 183 KRDVVSWNAIIAGYSQNGQPYEALALFSEMQVNGIKPNSSTLVSVMPVCAHLLALEQGKQ 242

Query: 129 VHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLPL 1
+H R+G+ D V + LV+MY + G + A +L +P+
Sbjct: 243 IHCYAIRSGI-ESDVLVVNGLVNMYAKCGNVNTAHKLFERMPI 284



Score = 85.9 bits (211), Expect = 9e-16
Identities = 46/161 (28%), Positives = 89/161 (55%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ V+ C+ ++H YA +G+ S + +V+++ + G ++ A K+F+ +
Sbjct: 225 VSVMPVCAHLLALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGNVNTAHKLFERMPI 284

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
+D +SW+++I GY N + AL + MQ +PN T+V+++ AC L +E+G ++
Sbjct: 285 RDVASWNAIIGGYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFALEQGQQI 344

Query: 126 HAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
H R+G ++ VG+ALV+MY + G + A +L +P
Sbjct: 345 HGYAIRSG-FESNDVVGNALVNMYAKCGNVNSAYKLFERMP 384



Score = 85.1 bits (209), Expect = 2e-15
Identities = 45/161 (27%), Positives = 89/161 (55%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ VL C+ ++H YA +G S+ +G +V+++ + G ++ A K+F+ +
Sbjct: 326 VSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVNMYAKCGNVNSAYKLFERMPK 385

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
K+ +W+++I+GY ++G AL L+ MQ +P+ F +V+++ AC +E+G ++
Sbjct: 386 KNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPACAHFLALEQGKQI 445

Query: 126 HAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
H R+G + VG+ LV +Y + G + AQ+L +P
Sbjct: 446 HGYTIRSG-FESNVVVGTGLVDIYAKCGNVNTAQKLFERMP 485



Score = 60.8 bits (146), Expect = 3e-08
Identities = 36/96 (37%), Positives = 50/96 (52%)
Frame = -2

Query: 291 WSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAID 112
W I GYV+NG AL LY MQ P+ +++I AC D++ G KVH I
Sbjct: 88 WKETIIGYVKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVHEDII 147

Query: 111 RTGVLHVDNFVGSALVSMYVEFGLLLKAQELCNTLP 4
G D VG+AL SMY + G L A+++ + +P
Sbjct: 148 ARG-FESDVIVGTALASMYTKCGSLENARQVFDRMP 182



Score = 53.9 bits (128), Expect = 4e-06
Identities = 30/117 (25%), Positives = 59/117 (50%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ VL C+ ++H Y +G S+ +GT +V ++ + G ++ AQK+F+ +
Sbjct: 427 VSVLPACAHFLALEQGKQIHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLFERMPE 486

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERG 136
+D SW+++I Y +G AL L+ MQ+ + + ++ AC V++G
Sbjct: 487 QDVVSWTTMILAYGIHGHGEDALALFSKMQETGTKLDHIAFTAILTACSHAGLVDQG 543


>tr|A7R4G1|A7R4G1_VITVI Chromosome undetermined scaffold_682, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00004379001 PE=4 SV=1
Length = 573

Score = 92.0 bits (227), Expect = 1e-17
Identities = 53/154 (34%), Positives = 84/154 (54%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
VL C A+ +H A G+ S + +++++V G +H A+K+FD + K
Sbjct: 51 VLKACGCKSAYWEAVLVHGLAIKLGIGSLVFVQNALIAVYVVCGLIHCARKLFDDITDKT 110

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHA 121
SW+S+I GY G A L+ M++ +P+GFT VNL++ C + +D++ G VH
Sbjct: 111 LVSWNSMIGGYAHMGNWKEAFLLFRKMREWGMEPDGFTFVNLLSVCSQSRDLDLGRYVHF 170

Query: 120 AIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQEL 19
I+ TGV +D V +ALV MY + G L AQ +
Sbjct: 171 CIEITGV-KIDIIVRNALVDMYAKCGNLHSAQAI 203



Score = 68.9 bits (167), Expect = 1e-10
Identities = 48/194 (24%), Positives = 93/194 (47%), Gaps = 32/194 (16%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLH--------------------SYASNNGLHSHSSL----- 385
++ +L CS+++D + +H YA LHS ++
Sbjct: 149 FVNLLSVCSQSRDLDLGRYVHFCIEITGVKIDIIVRNALVDMYAKCGNLHSAQAIFDRTQ 208

Query: 384 ------GTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGELGHALTLYEA 223
T M+S + + G + +A+++FD + K+ SW+S+I+ Y+ G+ AL L+
Sbjct: 209 EKNVVSWTSMISAYAQHGSIEVARQIFDQMPGKNVVSWNSMISCYLREGQYREALDLFNK 268

Query: 222 MQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAI-DRTGVLHVDNFVGSALVSMYVEF 46
M++ P+ TLV+++ AC +L D+ G K+H I G V + ++L+ MY +
Sbjct: 269 MRNSRVVPDEATLVSILAACSQLGDLVMGKKIHNYILSNKGAYGVTLY--NSLIDMYAKC 326

Query: 45 GLLLKAQELCNTLP 4
G ++ A ++ +P
Sbjct: 327 GPVVTALDIFLEMP 340



Score = 56.6 bits (135), Expect = 6e-07
Identities = 42/167 (25%), Positives = 82/167 (49%), Gaps = 5/167 (2%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ +L CS+ D ++ ++H+Y +N +L ++ ++ + G + A +F +
Sbjct: 282 VSILAACSQLGDLVMGKKIHNYILSNKGAYGVTLYNSLIDMYAKCGPVVTALDIFLEMPG 341

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
K+ SW+ +I +G A+ L+E MQ D P+ TL L++AC V+ G
Sbjct: 342 KNLVSWNVIIGALALHGCGLEAIKLFEEMQADGTLPDEITLTGLLSACSHSGLVDMGLYY 401

Query: 126 HAAIDRTGVLH-----VDNFVGSALVSMYVEFGLLLKAQELCNTLPL 1
DR GV++ ++++ + +V + GLL +A EL +P+
Sbjct: 402 ---FDRMGVIYRVTREIEHY--ACMVDLLGRGGLLGEAIELIGRMPM 443



Score = 40.8 bits (94), Expect = 0.035
Identities = 30/103 (29%), Positives = 52/103 (50%)
Frame = -2

Query: 327 VFDSLLCKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKD 148
+FD + ++ ++SLI GY + + A+ L+ M PN FTL ++ AC
Sbjct: 1 MFDQIPQPNKFMYNSLIRGYSNSDDPIDAVLLFRRMICSGLSPNEFTLPFVLKACGCKSA 60

Query: 147 VERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQEL 19
VH + G+ + FV +AL+++YV GL+ A++L
Sbjct: 61 YWEAVLVHGLAIKLGIGSL-VFVQNALIAVYVVCGLIHCARKL 102


>tr|A7R352|A7R352_VITVI Chromosome undetermined scaffold_484, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00013464001 PE=4 SV=1
Length = 573

Score = 92.0 bits (227), Expect = 1e-17
Identities = 53/154 (34%), Positives = 84/154 (54%)
Frame = -2

Query: 480 VLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKD 301
VL C A+ +H A G+ S + +++++V G +H A+K+FD + K
Sbjct: 51 VLKACGCKSAYWEAVLVHGLAIKLGIGSLVFVQNALIAVYVVCGLIHCARKLFDDITDKT 110

Query: 300 ESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHA 121
SW+S+I GY G A L+ M++ +P+GFT VNL++ C + +D++ G VH
Sbjct: 111 LVSWNSMIGGYAHMGNWKEAFLLFRKMREWGMEPDGFTFVNLLSVCSQSRDLDLGRYVHF 170

Query: 120 AIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQEL 19
I+ TGV +D V +ALV MY + G L AQ +
Sbjct: 171 CIEITGV-KIDIIVRNALVDMYAKCGNLHSAQAI 203



Score = 68.9 bits (167), Expect = 1e-10
Identities = 48/194 (24%), Positives = 93/194 (47%), Gaps = 32/194 (16%)
Frame = -2

Query: 489 YLQVLHTCSKAKDAIVALRLH--------------------SYASNNGLHSHSSL----- 385
++ +L CS+++D + +H YA LHS ++
Sbjct: 149 FVNLLSVCSQSRDLDLGRYVHFCIEITGVKIDIIVRNALVDMYAKCGNLHSAQAIFDRTQ 208

Query: 384 ------GTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGELGHALTLYEA 223
T M+S + + G + +A+++FD + K+ SW+S+I+ Y+ G+ AL L+
Sbjct: 209 EKNVVSWTSMISAYAQHGSIEVARQIFDQMPGKNVVSWNSMISCYLREGQYREALDLFNK 268

Query: 222 MQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAI-DRTGVLHVDNFVGSALVSMYVEF 46
M++ P+ TLV+++ AC +L D+ G K+H I G V + ++L+ MY +
Sbjct: 269 MRNSRVVPDEATLVSILAACSQLGDLVMGKKIHNYILSNKGAYGVTLY--NSLIDMYAKC 326

Query: 45 GLLLKAQELCNTLP 4
G ++ A ++ +P
Sbjct: 327 GPVVTALDIFLEMP 340



Score = 56.6 bits (135), Expect = 6e-07
Identities = 42/167 (25%), Positives = 82/167 (49%), Gaps = 5/167 (2%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
+ +L CS+ D ++ ++H+Y +N +L ++ ++ + G + A +F +
Sbjct: 282 VSILAACSQLGDLVMGKKIHNYILSNKGAYGVTLYNSLIDMYAKCGPVVTALDIFLEMPG 341

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
K+ SW+ +I +G A+ L+E MQ D P+ TL L++AC V+ G
Sbjct: 342 KNLVSWNVIIGALALHGCGLEAIKLFEEMQADGTLPDEITLTGLLSACSHSGLVDMGLYY 401

Query: 126 HAAIDRTGVLH-----VDNFVGSALVSMYVEFGLLLKAQELCNTLPL 1
DR GV++ ++++ + +V + GLL +A EL +P+
Sbjct: 402 ---FDRMGVIYRVPREIEHY--ACMVDLLGRGGLLGEAIELIGRMPM 443



Score = 40.8 bits (94), Expect = 0.035
Identities = 30/103 (29%), Positives = 52/103 (50%)
Frame = -2

Query: 327 VFDSLLCKDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKD 148
+FD + ++ ++SLI GY + + A+ L+ M PN FTL ++ AC
Sbjct: 1 MFDQIPQPNKFMYNSLIRGYSNSDDPIDAVLLFRRMICSGLSPNEFTLPFVLKACGCKSA 60

Query: 147 VERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQEL 19
VH + G+ + FV +AL+++YV GL+ A++L
Sbjct: 61 YWEAVLVHGLAIKLGIGSL-VFVQNALIAVYVVCGLIHCARKL 102


>tr|Q5QNL7|Q5QNL7_ORYSJ Pentatricopeptide repeat protein-like
OS=Oryza sativa subsp. japonica GN=P0451C06.22 PE=4 SV=1
Length = 658

Score = 91.7 bits (226), Expect = 2e-17
Identities = 53/142 (37%), Positives = 79/142 (55%)
Frame = -2

Query: 432 LHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGE 253
+H YA NG+ + ++ ++V+ G M A+ +FD + KD SW++LI GY +
Sbjct: 208 VHGYAIRNGIEEVLPVANALMEMYVKCGYMEEARFIFDHVTKKDTISWNTLIGGYSRSNL 267

Query: 252 LGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGS 73
A TL+ M L +PN T+ ++ A L +ERG ++HA R G L DNFV +
Sbjct: 268 ANEAFTLFNEMLLQL-RPNAVTMACILPAAASLSSLERGREMHAYAVRRGYLE-DNFVAN 325

Query: 72 ALVSMYVEFGLLLKAQELCNTL 7
ALV MYV+ G LL A+ L + L
Sbjct: 326 ALVDMYVKCGALLLARRLFDML 347



Score = 65.1 bits (157), Expect = 2e-09
Identities = 38/154 (24%), Positives = 76/154 (49%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
L V+ C ++ + + +H Y+ GL S +SLG ++ ++ K+F ++
Sbjct: 89 LSVMPACVQSHYSFIGGVVHGYSVRTGLISETSLGNALLDMYSNCSDWRSTNKIFRNMEQ 148

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
K+ SW+++I Y G L++ M + +P+ F + + ++A + ++ G V
Sbjct: 149 KNVVSWTAMITSYTRAGHFDKVAGLFQEMGLEGIRPDVFAITSALDAFAGNESLKHGKSV 208

Query: 126 HAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQ 25
H R G+ V V +AL+ MYV+ G + +A+
Sbjct: 209 HGYAIRNGIEEVLP-VANALMEMYVKCGYMEEAR 241



Score = 57.8 bits (138), Expect = 3e-07
Identities = 36/144 (25%), Positives = 69/144 (47%)
Frame = -2

Query: 432 LHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGE 253
+H+YA G + + +V ++V+ G + LA+++FD L K+ SW+ +I GY +G
Sbjct: 308 MHAYAVRRGYLEDNFVANALVDMYVKCGALLLARRLFDMLTNKNLISWTIMIAGYGMHGR 367

Query: 252 LGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGS 73
A+ L+E M+ QP+ + ++ AC + G + A+ + +
Sbjct: 368 GRDAIALFEQMKGSGIQPDAGSFSAILYACSHSGLRDEGWRFFNAMRNEHRIEPKLKHYA 427

Query: 72 ALVSMYVEFGLLLKAQELCNTLPL 1
+V + G L +A E T+P+
Sbjct: 428 CMVDLLCHTGNLKEAYEFIETMPI 451



Score = 56.6 bits (135), Expect = 6e-07
Identities = 36/128 (28%), Positives = 66/128 (51%)
Frame = -2

Query: 438 LRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVEN 259
L +H Y G + ++ ++S + + R+ A VFD + +D SW+S+I G N
Sbjct: 4 LVVHGYLVKYGFGAQCAVCNALISFYAKSNRIEDALMVFDEMPQRDIISWNSIIGGCASN 63

Query: 258 GELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFV 79
G A+ L+ M + + + TL++++ AC++ G VH RTG++ + +
Sbjct: 64 GLYDKAVELFVRMWLEGQELDSTTLLSVMPACVQSHYSFIGGVVHGYSVRTGLIS-ETSL 122

Query: 78 GSALVSMY 55
G+AL+ MY
Sbjct: 123 GNALLDMY 130


>tr|Q0JPS7|Q0JPS7_ORYSJ Os01g0205200 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os01g0205200 PE=4 SV=1
Length = 667

Score = 91.7 bits (226), Expect = 2e-17
Identities = 53/142 (37%), Positives = 79/142 (55%)
Frame = -2

Query: 432 LHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGE 253
+H YA NG+ + ++ ++V+ G M A+ +FD + KD SW++LI GY +
Sbjct: 217 VHGYAIRNGIEEVLPVANALMEMYVKCGYMEEARFIFDHVTKKDTISWNTLIGGYSRSNL 276

Query: 252 LGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGS 73
A TL+ M L +PN T+ ++ A L +ERG ++HA R G L DNFV +
Sbjct: 277 ANEAFTLFNEMLLQL-RPNAVTMACILPAAASLSSLERGREMHAYAVRRGYLE-DNFVAN 334

Query: 72 ALVSMYVEFGLLLKAQELCNTL 7
ALV MYV+ G LL A+ L + L
Sbjct: 335 ALVDMYVKCGALLLARRLFDML 356



Score = 65.1 bits (157), Expect = 2e-09
Identities = 38/154 (24%), Positives = 76/154 (49%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
L V+ C ++ + + +H Y+ GL S +SLG ++ ++ K+F ++
Sbjct: 98 LSVMPACVQSHYSFIGGVVHGYSVRTGLISETSLGNALLDMYSNCSDWRSTNKIFRNMEQ 157

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
K+ SW+++I Y G L++ M + +P+ F + + ++A + ++ G V
Sbjct: 158 KNVVSWTAMITSYTRAGHFDKVAGLFQEMGLEGIRPDVFAITSALDAFAGNESLKHGKSV 217

Query: 126 HAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQ 25
H R G+ V V +AL+ MYV+ G + +A+
Sbjct: 218 HGYAIRNGIEEVLP-VANALMEMYVKCGYMEEAR 250



Score = 57.8 bits (138), Expect = 3e-07
Identities = 36/144 (25%), Positives = 69/144 (47%)
Frame = -2

Query: 432 LHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGE 253
+H+YA G + + +V ++V+ G + LA+++FD L K+ SW+ +I GY +G
Sbjct: 317 MHAYAVRRGYLEDNFVANALVDMYVKCGALLLARRLFDMLTNKNLISWTIMIAGYGMHGR 376

Query: 252 LGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGS 73
A+ L+E M+ QP+ + ++ AC + G + A+ + +
Sbjct: 377 GRDAIALFEQMKGSGIQPDAGSFSAILYACSHSGLRDEGWRFFNAMRNEHRIEPKLKHYA 436

Query: 72 ALVSMYVEFGLLLKAQELCNTLPL 1
+V + G L +A E T+P+
Sbjct: 437 CMVDLLCHTGNLKEAYEFIETMPI 460



Score = 56.6 bits (135), Expect = 6e-07
Identities = 36/128 (28%), Positives = 66/128 (51%)
Frame = -2

Query: 438 LRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVEN 259
L +H Y G + ++ ++S + + R+ A VFD + +D SW+S+I G N
Sbjct: 13 LVVHGYLVKYGFGAQCAVCNALISFYAKSNRIEDALMVFDEMPQRDIISWNSIIGGCASN 72

Query: 258 GELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFV 79
G A+ L+ M + + + TL++++ AC++ G VH RTG++ + +
Sbjct: 73 GLYDKAVELFVRMWLEGQELDSTTLLSVMPACVQSHYSFIGGVVHGYSVRTGLIS-ETSL 131

Query: 78 GSALVSMY 55
G+AL+ MY
Sbjct: 132 GNALLDMY 139


>tr|A2ZQG6|A2ZQG6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_000788 PE=4 SV=1
Length = 818

Score = 91.7 bits (226), Expect = 2e-17
Identities = 53/142 (37%), Positives = 79/142 (55%)
Frame = -2

Query: 432 LHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGE 253
+H YA NG+ + ++ ++V+ G M A+ +FD + KD SW++LI GY +
Sbjct: 370 VHGYAIRNGIEEVLPVANALMEMYVKCGYMEEARFIFDHVTKKDTISWNTLIGGYSRSNL 429

Query: 252 LGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGS 73
A TL+ M L +PN T+ ++ A L +ERG ++HA R G L DNFV +
Sbjct: 430 ANEAFTLFNEMLLQL-RPNAVTMACILPAAASLSSLERGREMHAYAVRRGYLE-DNFVAN 487

Query: 72 ALVSMYVEFGLLLKAQELCNTL 7
ALV MYV+ G LL A+ L + L
Sbjct: 488 ALVDMYVKCGALLLARRLFDML 509



Score = 65.1 bits (157), Expect = 2e-09
Identities = 38/154 (24%), Positives = 76/154 (49%)
Frame = -2

Query: 486 LQVLHTCSKAKDAIVALRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLC 307
L V+ C ++ + + +H Y+ GL S +SLG ++ ++ K+F ++
Sbjct: 251 LSVMPACVQSHYSFIGGVVHGYSVRTGLISETSLGNALLDMYSNCSDWRSTNKIFRNMEQ 310

Query: 306 KDESSWSSLINGYVENGELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKV 127
K+ SW+++I Y G L++ M + +P+ F + + ++A + ++ G V
Sbjct: 311 KNVVSWTAMITSYTRAGHFDKVAGLFQEMGLEGIRPDVFAITSALDAFAGNESLKHGKSV 370

Query: 126 HAAIDRTGVLHVDNFVGSALVSMYVEFGLLLKAQ 25
H R G+ V V +AL+ MYV+ G + +A+
Sbjct: 371 HGYAIRNGIEEVLP-VANALMEMYVKCGYMEEAR 403



Score = 57.8 bits (138), Expect = 3e-07
Identities = 36/144 (25%), Positives = 69/144 (47%)
Frame = -2

Query: 432 LHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVENGE 253
+H+YA G + + +V ++V+ G + LA+++FD L K+ SW+ +I GY +G
Sbjct: 470 MHAYAVRRGYLEDNFVANALVDMYVKCGALLLARRLFDMLTNKNLISWTIMIAGYGMHGR 529

Query: 252 LGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGS 73
A+ L+E M+ QP+ + ++ AC + G + A+ + +
Sbjct: 530 GRDAIALFEQMKGSGIQPDAGSFSAILYACSHSGLRDEGWRFFNAMRNEHRIEPKLKHYA 589

Query: 72 ALVSMYVEFGLLLKAQELCNTLPL 1
+V + G L +A E T+P+
Sbjct: 590 CMVDLLCHTGNLKEAYEFIETMPI 613



Score = 56.6 bits (135), Expect = 6e-07
Identities = 36/128 (28%), Positives = 66/128 (51%)
Frame = -2

Query: 438 LRLHSYASNNGLHSHSSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDESSWSSLINGYVEN 259
L +H Y G + ++ ++S + + R+ A VFD + +D SW+S+I G N
Sbjct: 166 LVVHGYLVKYGFGAQCAVCNALISFYAKSNRIEDALMVFDEMPQRDIISWNSIIGGCASN 225

Query: 258 GELGHALTLYEAMQDDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFV 79
G A+ L+ M + + + TL++++ AC++ G VH RTG++ + +
Sbjct: 226 GLYDKAVELFVRMWLEGQELDSTTLLSVMPACVQSHYSFIGGVVHGYSVRTGLIS-ETSL 284

Query: 78 GSALVSMY 55
G+AL+ MY
Sbjct: 285 GNALLDMY 292



Score = 54.7 bits (130), Expect = 2e-06
Identities = 37/131 (28%), Positives = 65/131 (49%), Gaps = 1/131 (0%)
Frame = -2

Query: 393 SSLGTCMVSLFVEIGRMHLAQKVFDSLLCKDE-SSWSSLINGYVENGELGHALTLYEAMQ 217
S LG +V ++V+ G + A+KVFD++ K +W+ ++ GY + G+ +L L+E M
Sbjct: 79 SVLGRKLVLMYVKCGELGYARKVFDAMSSKSNLHAWNLMMGGYAKLGKFQESLLLFEKMH 138

Query: 216 DDLFQPNGFTLVNLINACIKLKDVERGCKVHAAIDRTGVLHVDNFVGSALVSMYVEFGLL 37
D P+ T+ L+ L V G VH + + G V +AL+S Y + +
Sbjct: 139 DCGITPDEHTISCLLKCITGLSGVMDGLVVHGYLVKYG-FGAQCAVCNALISFYAKSNRI 197

Query: 36 LKAQELCNTLP 4
A + + +P
Sbjct: 198 EDALMVFDEMP 208