BP912710
Clone id YMU001_000022_A05
Library
Length 548
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000022_A05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTTCAGCGACAGGTCACTAAAGTCCCTTGTGGTTAGTGAAGATGAGGAAGCACCAGCAAG
CAATTTCATAGTGAATGGAAGGGCCAGCATCTTGAAGAGGACTGAAGAGTCCCCTAGAAG
TCTTCGGTCCGGTGGCCTTCGGTCCGGTGGCAATTCCCATATGATGAGTAGCCCGAGGGG
AAAATTTTCTTATTACTTACCTGAGAAGGAATTCAGCCGGCTTGCATCAGAAACTAATCA
AAATGCAAGTGGTTTTTCTGGGAAGATTAGTCATGCATCACCAAGGGCTATGTCTTATAG
GAGCATGAGCTTCAATTATCATAAACAACGTTATGGAAATCATCCTGACAGACAGGATGC
TTTAAAGGGTGTACCTCTTACACCAGCACCGAGGTGCAATGCGTACACCGGCGGAAATCC
AAACCAGGTTTCTTTAGGAGACATGAGTGATGAAGAGTGGGTAAGCTTCTTGCGCGTTTT
CAATGAGCTCTTGGAGCAGGCGCTAGCAACTATGTGCACTCAGAAGGCAAGCCATAGGCA
GAGGCTTG
■■Homology search results ■■ -
sp_hit_id P46941
Definition sp|P46941|TG325_CAEEL WW domain-containing protein tag-325 OS=Caenorhabditis elegans
Align length 90
Score (bit) 33.9
E-value 0.53
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912710|Adiantum capillus-veneris mRNA, clone:
YMU001_000022_A05.
(548 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P46941|TG325_CAEEL WW domain-containing protein tag-325 OS=Ca... 34 0.53
sp|Q6NU13|SPT2_XENLA Protein SPT2 homolog OS=Xenopus laevis GN=s... 31 4.5

>sp|P46941|TG325_CAEEL WW domain-containing protein tag-325
OS=Caenorhabditis elegans GN=tag-325 PE=2 SV=1
Length = 837

Score = 33.9 bits (76), Expect = 0.53
Identities = 24/90 (26%), Positives = 37/90 (41%), Gaps = 10/90 (11%)
Frame = +2

Query: 218 RLASETNQNASGFSGKISHAS----PRAMSYRSMSFNYHKQRYGNHPDRQDALK-GVPLT 382
R S TN + F K + P+ + S SF++H Q + N PDR ++ T
Sbjct: 308 RRPSPTNLRSVSFQNKCTVLKNVPMPQVLPTTSSSFDHHPQYHSNTPDRPILMEDSADFT 367

Query: 383 PAPRCNAYTGGNPNQ-----VSLGDMSDEE 457
P+ RC G + + GD+ E
Sbjct: 368 PSSRCEERRGSGDGREPVRTIRCGDLERSE 397


>sp|Q6NU13|SPT2_XENLA Protein SPT2 homolog OS=Xenopus laevis
GN=spty2d1 PE=2 SV=1
Length = 800

Score = 30.8 bits (68), Expect = 4.5
Identities = 25/87 (28%), Positives = 35/87 (40%), Gaps = 3/87 (3%)
Frame = +2

Query: 179 GKFSYYLPEKEFSRLASETNQNASGFSGKISHASPRAMSYRSMSFNYHKQRYGN---HPD 349
G S + + S +A +SG + S +PRA S + S NY +Q + P
Sbjct: 528 GSVSSFARPRSNSSMAPAKPAASSGSARPSSSGTPRASSTGNSSSNYSRQASSSGAVRPS 587

Query: 350 RQDALKGVPLTPAPRCNAYTGGNPNQV 430
G P P+PR G PN V
Sbjct: 588 SGPPTGGTPKGPSPR----PGTGPNSV 610


tr_hit_id A7PGG7
Definition tr|A7PGG7|A7PGG7_VITVI Chromosome chr17 scaffold_16, whole genome shotgun sequence OS=Vitis vinifera
Align length 72
Score (bit) 38.9
E-value 0.18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912710|Adiantum capillus-veneris mRNA, clone:
YMU001_000022_A05.
(548 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PGG7|A7PGG7_VITVI Chromosome chr17 scaffold_16, whole genom... 39 0.18
tr|Q9SI52|Q9SI52_ARATH Expressed protein (At2g03890/T18C20.9) OS... 39 0.23
tr|Q3EC75|Q3EC75_ARATH Uncharacterized protein At2g03890.2 OS=Ar... 39 0.23
tr|Q0WMJ0|Q0WMJ0_ARATH Putative uncharacterized protein At2g0389... 39 0.23
tr|A5B9G7|A5B9G7_VITVI Putative uncharacterized protein (Chromos... 38 0.40
tr|Q9LMY3|Q9LMY3_ARATH F21F23.8 protein OS=Arabidopsis thaliana ... 37 0.89
tr|Q8W4R8|Q8W4R8_ARATH At1g13640/F21F23_7 OS=Arabidopsis thalian... 37 0.89
tr|A9RS96|A9RS96_PHYPA Predicted protein (Fragment) OS=Physcomit... 37 0.89
tr|Q9C671|Q9C671_ARATH Putative uncharacterized protein F28B23.7... 36 1.2
tr|Q1KUZ6|Q1KUZ6_9ROSI Putative uncharacterized protein OS=Cleom... 36 1.2
tr|B2B0T1|B2B0T1_PODAN Predicted CDS Pa_3_7210 OS=Podospora anse... 36 1.2
tr|A4U7F9|A4U7F9_DANRE Procollagen lysine 2-oxoglutarate 5-dioxy... 36 1.5
tr|B4KQ56|B4KQ56_DROMO GI19188 OS=Drosophila mojavensis GN=GI191... 35 2.0
tr|A5K0I8|A5K0I8_PLAVI Putative uncharacterized protein OS=Plasm... 35 2.6
tr|A7PTD6|A7PTD6_VITVI Chromosome chr8 scaffold_29, whole genome... 35 3.4
tr|A5A6S3|A5A6S3_FUGRU Lysyl hydroxylase 2 OS=Fugu rubripes GN=f... 34 4.4
tr|A7PAF8|A7PAF8_VITVI Chromosome chr14 scaffold_9, whole genome... 34 4.4
tr|A7MB83|A7MB83_BOVIN PLOD2 protein OS=Bos taurus GN=PLOD2 PE=2... 34 4.4
tr|B4DHG3|B4DHG3_HUMAN cDNA FLJ55329, highly similar to Procolla... 34 4.4
tr|Q3L9Q9|Q3L9Q9_RHOE4 Putative transcriptional regulator, ArsR ... 34 5.8
tr|B3KWS3|B3KWS3_HUMAN cDNA FLJ43712 fis, clone TESOP2004114, hi... 33 7.5
tr|A8SC28|A8SC28_9FIRM Putative uncharacterized protein OS=Faeca... 33 9.8

>tr|A7PGG7|A7PGG7_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017552001
PE=4 SV=1
Length = 629

Score = 38.9 bits (89), Expect = 0.18
Identities = 26/72 (36%), Positives = 30/72 (41%)
Frame = +2

Query: 332 YGNHPDRQDALKGVPLTPAPRCNAYTGGNPNQVSLGDMSDEEWVSFLRVFNELLEQALAT 511
YG P A G N + V+L DMS+EEW FL F ELL A A
Sbjct: 552 YGGIPKGARAGGGTSSGNRRSANEQLAATTSFVTLADMSEEEWNLFLERFKELLYPAFAN 611

Query: 512 MCTQKASHRQRL 547
+ RQRL
Sbjct: 612 RQSATLRQRQRL 623


>tr|Q9SI52|Q9SI52_ARATH Expressed protein (At2g03890/T18C20.9)
OS=Arabidopsis thaliana GN=At2g03890 PE=2 SV=2
Length = 650

Score = 38.5 bits (88), Expect = 0.23
Identities = 20/40 (50%), Positives = 23/40 (57%)
Frame = +2

Query: 428 VSLGDMSDEEWVSFLRVFNELLEQALATMCTQKASHRQRL 547
V + DM ++EWV FL F ELL A A T S RQRL
Sbjct: 605 VKVADMKEDEWVLFLERFQELLGPAFAKRKTATLSKRQRL 644


>tr|Q3EC75|Q3EC75_ARATH Uncharacterized protein At2g03890.2
OS=Arabidopsis thaliana GN=At2g03890 PE=4 SV=1
Length = 530

Score = 38.5 bits (88), Expect = 0.23
Identities = 20/40 (50%), Positives = 23/40 (57%)
Frame = +2

Query: 428 VSLGDMSDEEWVSFLRVFNELLEQALATMCTQKASHRQRL 547
V + DM ++EWV FL F ELL A A T S RQRL
Sbjct: 485 VKVADMKEDEWVLFLERFQELLGPAFAKRKTATLSKRQRL 524


>tr|Q0WMJ0|Q0WMJ0_ARATH Putative uncharacterized protein At2g03890
(Fragment) OS=Arabidopsis thaliana GN=At2g03890 PE=2
SV=1
Length = 191

Score = 38.5 bits (88), Expect = 0.23
Identities = 20/40 (50%), Positives = 23/40 (57%)
Frame = +2

Query: 428 VSLGDMSDEEWVSFLRVFNELLEQALATMCTQKASHRQRL 547
V + DM ++EWV FL F ELL A A T S RQRL
Sbjct: 146 VKVADMKEDEWVLFLERFQELLGPAFAKRKTATLSKRQRL 185


>tr|A5B9G7|A5B9G7_VITVI Putative uncharacterized protein (Chromosome
chr1 scaffold_22, whole genome shotgun sequence)
OS=Vitis vinifera GN=GSVIVT00021148001 PE=4 SV=1
Length = 640

Score = 37.7 bits (86), Expect = 0.40
Identities = 32/111 (28%), Positives = 44/111 (39%), Gaps = 5/111 (4%)
Frame = +2

Query: 227 SETNQNASGFSG-----KISHASPRAMSYRSMSFNYHKQRYGNHPDRQDALKGVPLTPAP 391
SE F+G ++S S +MS + S Q+Y L +
Sbjct: 522 SEREGEQEDFAGIPTPAEVSTISKLSMSLKDTSLGEKSQKYLEAKPESSYLANTS-SGHR 580

Query: 392 RCNAYTGGNPNQVSLGDMSDEEWVSFLRVFNELLEQALATMCTQKASHRQR 544
N + + V L DM++EEWV FL F ELL A A + RQR
Sbjct: 581 SANEQLPTSMSFVKLADMNEEEWVLFLEKFQELLYPAFAKRKSVTLGQRQR 631


>tr|Q9LMY3|Q9LMY3_ARATH F21F23.8 protein OS=Arabidopsis thaliana
GN=F21F23.8 PE=4 SV=1
Length = 620

Score = 36.6 bits (83), Expect = 0.89
Identities = 20/42 (47%), Positives = 22/42 (52%)
Frame = +2

Query: 422 NQVSLGDMSDEEWVSFLRVFNELLEQALATMCTQKASHRQRL 547
N V L DM + EWV FL F ELL A A T + QRL
Sbjct: 573 NFVKLADMKEVEWVVFLERFQELLYSAFAERKTMTLRNTQRL 614


>tr|Q8W4R8|Q8W4R8_ARATH At1g13640/F21F23_7 OS=Arabidopsis thaliana
GN=At1g13640 PE=2 SV=1
Length = 622

Score = 36.6 bits (83), Expect = 0.89
Identities = 20/42 (47%), Positives = 22/42 (52%)
Frame = +2

Query: 422 NQVSLGDMSDEEWVSFLRVFNELLEQALATMCTQKASHRQRL 547
N V L DM + EWV FL F ELL A A T + QRL
Sbjct: 575 NFVKLADMKEVEWVVFLERFQELLYSAFAERKTMTLRNTQRL 616


>tr|A9RS96|A9RS96_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_118568 PE=4 SV=1
Length = 576

Score = 36.6 bits (83), Expect = 0.89
Identities = 36/121 (29%), Positives = 51/121 (42%), Gaps = 5/121 (4%)
Frame = +2

Query: 200 PEKEFSRLASETNQNASGFSGKISHASPRAMSYRSMSFNYHKQRYGNHPDRQDALKGVPL 379
P+ FS S +N N S ++S S R+ S + F H Q H + +
Sbjct: 458 PDNSFS---SPSNDNQSYSLSRMSVPS-RSTSLKIGKFRSHTQIEKPHTIGLRGYAAMNV 513

Query: 380 TPAPRCNAYTGGNPNQVS-----LGDMSDEEWVSFLRVFNELLEQALATMCTQKASHRQR 544
RC N N + L DMS++EW FL F ELL +A A + + + QR
Sbjct: 514 AQNVRCTK----NANDLIHGPLILADMSEKEWSLFLEGFQELLPEAFAEVKFKSKNQVQR 569

Query: 545 L 547
L
Sbjct: 570 L 570


>tr|Q9C671|Q9C671_ARATH Putative uncharacterized protein F28B23.7
(At1g26270/F28B23_7) (Putative uncharacterized protein
At1g26270) OS=Arabidopsis thaliana GN=At1g26270 PE=2
SV=1
Length = 630

Score = 36.2 bits (82), Expect = 1.2
Identities = 25/87 (28%), Positives = 40/87 (45%), Gaps = 1/87 (1%)
Frame = +2

Query: 287 AMSYRSMSFNYHKQRYGNHPDRQDALKGVPLTPAPR-CNAYTGGNPNQVSLGDMSDEEWV 463
+MS +S Q+Y HP + ++ + A R + + + V L DMS+EEW
Sbjct: 537 SMSLKSTLLGEKSQKYQKHPGAR--VESAYASSAHRSADEQIPSSTSFVKLSDMSEEEWT 594

Query: 464 SFLRVFNELLEQALATMCTQKASHRQR 544
FL + ELL A+ + +QR
Sbjct: 595 IFLEKYQELLYPAIEKRKSITLGQKQR 621


>tr|Q1KUZ6|Q1KUZ6_9ROSI Putative uncharacterized protein OS=Cleome
spinosa PE=4 SV=1
Length = 611

Score = 36.2 bits (82), Expect = 1.2
Identities = 17/46 (36%), Positives = 27/46 (58%), Gaps = 4/46 (8%)
Frame = +2

Query: 413 GNPNQVSLGDMSDEEWVSFLRVFNELLEQAL----ATMCTQKASHR 538
G+ + V L DMS+EEW+ +L +F ++L A ++ QK HR
Sbjct: 559 GSSSFVKLSDMSEEEWLQYLEIFQKMLNPAFTRRNSSRSDQKLRHR 604