BP912717
Clone id YMU001_000022_B01
Library
Length 279
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000022_B01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTTTTTTTTTTTTTTTTTTGCGACAACCACAGCATATAGGTAATCAATGGG
ATGCTGGAATTTAGGGGATACACTTGAGGATATTTGAGTTTTTCCAAGAGTGTACCAGGA
GGCATCTCATTCAGGATTGCCCTCAATATCCTGATAGAGCAGTAAAAACACCTATAAGCA
TGAATTTCAAGTGCTTCAGATTCAGAGCAATTGTCTTGTGAACGCAGTAACAAGAGCTCA
GGCACAGGATGCATTGGGTATGTGTGGAAACTATCTCCT
■■Homology search results ■■ -
sp_hit_id Q9BSH3
Definition sp|Q9BSH3|NICN1_HUMAN Nicolin-1 OS=Homo sapiens
Align length 64
Score (bit) 30.4
E-value 2.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912717|Adiantum capillus-veneris mRNA, clone:
YMU001_000022_B01.
(251 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9BSH3|NICN1_HUMAN Nicolin-1 OS=Homo sapiens GN=NICN1 PE=2 SV=1 30 2.8
sp|Q92JI6|TLCA_RICCN ADP,ATP carrier protein 1 OS=Rickettsia con... 30 3.7
sp|Q861Y6|NICN1_CANFA Nicolin-1 OS=Canis familiaris GN=NICN1 PE=... 29 8.3
sp|Q9UTR7|MCP3_SCHPO Meiotic coiled-coil protein 3 OS=Schizosacc... 29 8.3
sp|Q86X29|LSR_HUMAN Lipolysis-stimulated lipoprotein receptor OS... 29 8.3

>sp|Q9BSH3|NICN1_HUMAN Nicolin-1 OS=Homo sapiens GN=NICN1 PE=2 SV=1
Length = 213

Score = 30.4 bits (67), Expect = 2.8
Identities = 19/64 (29%), Positives = 28/64 (43%)
Frame = -2

Query: 193 SQDNCSESEALEIHAYRCFYCSIRILRAILNEMPPGTLLEKLKYPQVYPLNSSIPLITYM 14
S++ E +L H C I LR IL + P L ++ Q+Y P +T+
Sbjct: 89 SEEGAQEYVSLFKHQMLCDMARISELRLILRQPSPLWLSFTVEELQIYQQGPKSPSVTFP 148

Query: 13 LWLS 2
WLS
Sbjct: 149 KWLS 152


>sp|Q92JI6|TLCA_RICCN ADP,ATP carrier protein 1 OS=Rickettsia
conorii GN=tlcA PE=3 SV=1
Length = 498

Score = 30.0 bits (66), Expect = 3.7
Identities = 14/48 (29%), Positives = 24/48 (50%)
Frame = -3

Query: 201 YCVHKTIALNLKHLKFMLIGVFTALSGY*GQS*MRCLLVHSWKNSNIL 58
YC+H+ + +HLKF+ + V S + +L + W N N+L
Sbjct: 204 YCLHEKTQIVAEHLKFVPLFVIMITSSF------LVILTYRWMNKNVL 245


>sp|Q861Y6|NICN1_CANFA Nicolin-1 OS=Canis familiaris GN=NICN1 PE=3
SV=1
Length = 213

Score = 28.9 bits (63), Expect = 8.3
Identities = 18/64 (28%), Positives = 28/64 (43%)
Frame = -2

Query: 193 SQDNCSESEALEIHAYRCFYCSIRILRAILNEMPPGTLLEKLKYPQVYPLNSSIPLITYM 14
S++ E +L H C + LR IL + P L ++ Q+Y P +T+
Sbjct: 89 SEEGAQEYVSLFKHQMLCDMARVLELRLILRQPSPLWLSFTVEELQIYQQGPKSPSMTFP 148

Query: 13 LWLS 2
WLS
Sbjct: 149 KWLS 152


>sp|Q9UTR7|MCP3_SCHPO Meiotic coiled-coil protein 3
OS=Schizosaccharomyces pombe GN=mcp3 PE=1 SV=1
Length = 952

Score = 28.9 bits (63), Expect = 8.3
Identities = 14/41 (34%), Positives = 24/41 (58%)
Frame = -2

Query: 142 CFYCSIRILRAILNEMPPGTLLEKLKYPQVYPLNSSIPLIT 20
CFYCS +I++ I NE G +E ++ + L ++P +T
Sbjct: 90 CFYCSRKIIKCICNEEHVG--IESVQLKLILLLCQNLPNVT 128


>sp|Q86X29|LSR_HUMAN Lipolysis-stimulated lipoprotein receptor
OS=Homo sapiens GN=LSR PE=1 SV=4
Length = 649

Score = 28.9 bits (63), Expect = 8.3
Identities = 19/43 (44%), Positives = 26/43 (60%), Gaps = 2/43 (4%)
Frame = -1

Query: 125 QDIEGNPE*DASWYTLGKTQISSSVSPKFQ-HPI-DYLYAVVV 3
QD++GN E A LG+T + + P FQ PI D+L+ VVV
Sbjct: 224 QDLQGNNEAYAELIVLGRTSGVAELLPGFQAGPIEDWLFVVVV 266


tr_hit_id B7AQ87
Definition tr|B7AQ87|B7AQ87_9BACE Putative uncharacterized protein OS=Bacteroides pectinophilus ATCC 43243
Align length 64
Score (bit) 33.9
E-value 4.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912717|Adiantum capillus-veneris mRNA, clone:
YMU001_000022_B01.
(251 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7AQ87|B7AQ87_9BACE Putative uncharacterized protein OS=Bacte... 34 4.2
tr|B7BJ34|B7BJ34_9CLOT Putative uncharacterized protein OS=Clost... 33 5.5
tr|B7BMC2|B7BMC2_9CLOT Putative uncharacterized protein OS=Clost... 33 7.2
tr|B0NBA8|B0NBA8_EUBSP Phosphorylase OS=Clostridium scindens ATC... 33 7.2
tr|A7VHF2|A7VHF2_9CLOT Phosphorylase OS=Clostridium sp. L2-50 GN... 33 7.2
tr|A5KLR0|A5KLR0_9FIRM Phosphorylase OS=Ruminococcus torques ATC... 33 7.2

>tr|B7AQ87|B7AQ87_9BACE Putative uncharacterized protein
OS=Bacteroides pectinophilus ATCC 43243 GN=BACPEC_00843
PE=4 SV=1
Length = 426

Score = 33.9 bits (76), Expect = 4.2
Identities = 23/64 (35%), Positives = 34/64 (53%)
Frame = -2

Query: 235 TYPMHPVPELLLLRSQDNCSESEALEIHAYRCFYCSIRILRAILNEMPPGTLLEKLKYPQ 56
T+P +PEL+ + +Q S EA+ I ++ C Y + IL L E P LEK PQ
Sbjct: 287 THPSMIIPELIRILTQRGISFDEAVGIVSHTCAYTNHTILAEAL-ETWPAAYLEK-AVPQ 344

Query: 55 VYPL 44
+ P+
Sbjct: 345 LVPI 348


>tr|B7BJ34|B7BJ34_9CLOT Putative uncharacterized protein
OS=Clostridium hylemonae DSM 15053 GN=CLOHYLEM_00511
PE=4 SV=1
Length = 768

Score = 33.5 bits (75), Expect = 5.5
Identities = 24/70 (34%), Positives = 36/70 (51%)
Frame = -2

Query: 235 TYPMHPVPELLLLRSQDNCSESEALEIHAYRCFYCSIRILRAILNEMPPGTLLEKLKYPQ 56
T+P +PEL+ L + N +EA+EI C Y + IL L E P LE++ PQ
Sbjct: 291 THPSMVIPELIRLLVERNIDFNEAVEIVQKTCAYTNHTILAEAL-ETWPLAYLEQVA-PQ 348

Query: 55 VYPLNSSIPL 26
+ P+ + L
Sbjct: 349 IVPIIKELDL 358


>tr|B7BMC2|B7BMC2_9CLOT Putative uncharacterized protein
OS=Clostridium hylemonae DSM 15053 GN=CLOHYLEM_01657
PE=4 SV=1
Length = 750

Score = 33.1 bits (74), Expect = 7.2
Identities = 22/64 (34%), Positives = 34/64 (53%)
Frame = -2

Query: 235 TYPMHPVPELLLLRSQDNCSESEALEIHAYRCFYCSIRILRAILNEMPPGTLLEKLKYPQ 56
T+P +PEL+ L ++ S EA+EI C Y + IL L + P + LEK+ P
Sbjct: 274 THPSMVIPELIRLMTERGISFDEAVEIVTKTCAYTNHTILAEALEKWPL-SYLEKV-VPH 331

Query: 55 VYPL 44
+ P+
Sbjct: 332 LVPI 335


>tr|B0NBA8|B0NBA8_EUBSP Phosphorylase OS=Clostridium scindens ATCC
35704 GN=CLOSCI_00729 PE=3 SV=1
Length = 754

Score = 33.1 bits (74), Expect = 7.2
Identities = 21/64 (32%), Positives = 32/64 (50%)
Frame = -2

Query: 235 TYPMHPVPELLLLRSQDNCSESEALEIHAYRCFYCSIRILRAILNEMPPGTLLEKLKYPQ 56
T+P +PEL+ L Q+ +EA+EI C Y + IL L + P L + PQ
Sbjct: 277 THPSMVIPELIRLLVQNQIDFNEAIEIVQKTCAYTNHTILAEALEKWPLDYLEQVA--PQ 334

Query: 55 VYPL 44
+ P+
Sbjct: 335 IVPI 338


>tr|A7VHF2|A7VHF2_9CLOT Phosphorylase OS=Clostridium sp. L2-50
GN=CLOL250_02349 PE=3 SV=1
Length = 1255

Score = 33.1 bits (74), Expect = 7.2
Identities = 23/64 (35%), Positives = 33/64 (51%)
Frame = -2

Query: 235 TYPMHPVPELLLLRSQDNCSESEALEIHAYRCFYCSIRILRAILNEMPPGTLLEKLKYPQ 56
T+P +PEL+ L ++ S EA EI C Y + IL L + P LEK+ PQ
Sbjct: 780 THPSMVIPELIRLLMEEGISFDEATEIVTDVCAYTNHTILAEALEKWPV-AYLEKV-VPQ 837

Query: 55 VYPL 44
+ P+
Sbjct: 838 LMPV 841


>tr|A5KLR0|A5KLR0_9FIRM Phosphorylase OS=Ruminococcus torques ATCC
27756 GN=RUMTOR_01164 PE=3 SV=1
Length = 755

Score = 33.1 bits (74), Expect = 7.2
Identities = 20/64 (31%), Positives = 32/64 (50%)
Frame = -2

Query: 235 TYPMHPVPELLLLRSQDNCSESEALEIHAYRCFYCSIRILRAILNEMPPGTLLEKLKYPQ 56
T+P +PEL+ L + EA+++ + C Y + IL L + P G L K PQ
Sbjct: 276 THPTMVIPELIRLLVERGLDIDEAIDVVSRTCAYTNHTILAEALEKWPIGYL--KKVVPQ 333

Query: 55 VYPL 44
+ P+
Sbjct: 334 LVPI 337