BP912729
Clone id YMU001_000022_C01
Library
Length 519
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000022_C01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGGTACTCCCAACTTGTAGGTTACCAAGCGGGTTTTCTATCAAGGATTGGGCTGTTTCAA
TCATCTTTTGACACATTTCCAGCCTCTGTTTTTCTATTTCGGCATATGGATAAGTCATCC
ATCTTTGCTCTTGGGTTTGGTTATTTGTGGATCTGGCTTCGTACGCTTTTAAAAGTGCCT
CTAACTGCTCATTTACCTTTTCTGCCAACAGTGATCCTCTTGCACCTGCACTTCTGGGTT
CTACTATTGCCTTGGGTACTATGGTTGCCGCAGTGTGTGAGCTTAGACTAGCTAGATCCT
CTAACCGCTCTAATCTATCCTTTGTGTGTTTTAACTCCTCGGATAGAGCCGTTTTCTCTC
GTTCTCTCCTGGCTTCATACGCGCCTTTCTAGCTTTCTAAGTGCGTCTTTGATTTTTCAT
ATTTGAACTTGGGACATCGGTTCTTGGCTCTTCAATTATGGGTTCATTCGTCATTCTTTG
AGCTTGGGCTCGTATCACTGCGTGAATAGGTATTACTGT
■■Homology search results ■■ -
sp_hit_id Q5TZA2
Definition sp|Q5TZA2|CROCC_HUMAN Rootletin OS=Homo sapiens
Align length 123
Score (bit) 36.6
E-value 0.072
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912729|Adiantum capillus-veneris mRNA, clone:
YMU001_000022_C01.
(519 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5TZA2|CROCC_HUMAN Rootletin OS=Homo sapiens GN=CROCC PE=1 SV=1 37 0.072
sp|Q8VYU8|ICR5_ARATH Interactor of constitutive active ROPs 5 OS... 34 0.47
sp|Q9D180|YA046_MOUSE Uncharacterized protein ENSP00000361571 ho... 33 0.61
sp|Q43008|SODM_ORYSJ Superoxide dismutase [Mn], mitochondrial OS... 33 0.80
sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4 33 0.80
sp|Q8N9E0|F133A_HUMAN Protein FAM133A OS=Homo sapiens GN=FAM133A... 33 0.80
sp|Q5ZL35|ARGL1_CHICK Arginine and glutamate-rich protein 1 OS=G... 33 0.80
sp|Q9YCB6|RGYR1_AERPE Reverse gyrase 1 OS=Aeropyrum pernix GN=rg... 33 1.0
sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus GN... 32 1.4
sp|Q15075|EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens GN... 32 1.4
sp|Q62377|U2AFM_MOUSE U2 small nuclear ribonucleoprotein auxilia... 32 1.8
sp|P09233|SODM1_MAIZE Superoxide dismutase [Mn] 3.1, mitochondri... 32 1.8
sp|Q6FTR8|PXR1_CANGA Protein PXR1 OS=Candida glabrata GN=PXR1 PE... 32 1.8
sp|O74424|NU211_SCHPO Nucleoporin nup211 OS=Schizosaccharomyces ... 32 1.8
sp|Q9ULE4|F184B_HUMAN Protein FAM184B OS=Homo sapiens GN=FAM184B... 32 1.8
sp|Q640L5|CCD18_MOUSE Coiled-coil domain-containing protein 18 O... 32 1.8
sp|P75310|Y474_MYCPN Uncharacterized protein MG328 homolog OS=My... 32 2.3
sp|P41979|SODM3_MAIZE Superoxide dismutase [Mn] 3.3, mitochondri... 32 2.3
sp|Q2GZN9|NST1_CHAGB Stress response protein NST1 OS=Chaetomium ... 32 2.3
sp|P26042|MOES_PIG Moesin OS=Sus scrofa GN=MSN PE=2 SV=3 32 2.3
sp|P26038|MOES_HUMAN Moesin OS=Homo sapiens GN=MSN PE=1 SV=3 32 2.3
sp|Q2HJ49|MOES_BOVIN Moesin OS=Bos taurus GN=MSN PE=2 SV=3 32 2.3
sp|Q09459|YQ38_CAEEL Uncharacterized protein C09G5.8 OS=Caenorha... 31 3.0
sp|Q9YFZ1|RAD50_AERPE DNA double-strand break repair rad50 ATPas... 31 3.0
sp|Q9Y2K3|MYH15_HUMAN Myosin-15 OS=Homo sapiens GN=MYH15 PE=1 SV=4 31 3.0
sp|Q9BY44|EIF2A_HUMAN Eukaryotic translation initiation factor 2... 31 3.0
sp|P09122|DPO3X_BACSU DNA polymerase III subunit gamma/tau OS=Ba... 31 3.0
sp|P50533|SMC2_XENLA Structural maintenance of chromosomes prote... 31 4.0
sp|Q9KVQ7|RMUC_VIBCH DNA recombination protein rmuC homolog OS=V... 31 4.0
sp|P04907|GSTF3_MAIZE Glutathione S-transferase 3 OS=Zea mays GN... 31 4.0

>sp|Q5TZA2|CROCC_HUMAN Rootletin OS=Homo sapiens GN=CROCC PE=1 SV=1
Length = 2017

Score = 36.6 bits (83), Expect = 0.072
Identities = 31/123 (25%), Positives = 56/123 (45%), Gaps = 1/123 (0%)
Frame = -3

Query: 382 AYEARREREKT-ALSEELKHTKDRLERLEDLASLSSHTAATIVPKAIVEPRSAGARGSLL 206
A E R+EREK A EEL+ +DRLE ++ A + ++ + + S+L
Sbjct: 619 AEELRQEREKLQAAQEELRRQRDRLEEEQEDAVQDGARVRRELERSHRQLEQLEGKRSVL 678

Query: 205 AEKVNEQLEALLKAYEARSTNNQTQEQRWMTYPYAEIEKQRLEMCQKMIETAQSLIENPL 26
A+++ E EAL +A R + + AE + LE+ + ++ +++ L
Sbjct: 679 AKELVEVREALSRATLQRDMLQAEKAEVAEALTKAEAGRVELELSMTKLRAEEASLQDSL 738

Query: 25 GNL 17
L
Sbjct: 739 SKL 741


>sp|Q8VYU8|ICR5_ARATH Interactor of constitutive active ROPs 5
OS=Arabidopsis thaliana GN=ICR5 PE=2 SV=2
Length = 396

Score = 33.9 bits (76), Expect = 0.47
Identities = 30/121 (24%), Positives = 57/121 (47%), Gaps = 4/121 (3%)
Frame = -3

Query: 382 AYEARREREKTALSEELKHTKDRLE--RLEDLASLSSHTAATIVPKAIVEPRSAGARGSL 209
A ++R + + L+EEL TKD +E R E + + + + K +E RGSL
Sbjct: 260 AVKSRYSQREAELTEELNRTKDEIEGLRKELMEKVKEDESTGDLKK--LESDLMEVRGSL 317

Query: 208 LAEKVNEQLEALLKAYEARSTNNQTQEQRWMTYPYAEIEKQRL--EMCQKMIETAQSLIE 35
+ +++ Q+ + + N + E AE+++ ++ E +K ETA S++
Sbjct: 318 MDKEMELQILRSAMEKKVETANTEAME--------AELKRVKIQCEQWRKAAETAASILN 369

Query: 34 N 32
N
Sbjct: 370 N 370


>sp|Q9D180|YA046_MOUSE Uncharacterized protein ENSP00000361571
homolog OS=Mus musculus PE=2 SV=2
Length = 550

Score = 33.5 bits (75), Expect = 0.61
Identities = 25/83 (30%), Positives = 40/83 (48%), Gaps = 4/83 (4%)
Frame = -3

Query: 361 REKTALSEELKHTKDRLERLEDLASLSSHTAATIVPKAIVEPRSAGARGSLLAEKVNEQL 182
+E L ELK T+ ++ LE +S T + VP++++ S GS ++NEQ
Sbjct: 442 KEINELRRELKLTRSQIYDLESALKVSKKTRSQEVPESVI---SKDVVGSTSTMRLNEQE 498

Query: 181 EA----LLKAYEARSTNNQTQEQ 125
E ++ E R +Q QEQ
Sbjct: 499 ETGRIIEMQRLEIRRLRDQIQEQ 521


>sp|Q43008|SODM_ORYSJ Superoxide dismutase [Mn], mitochondrial
OS=Oryza sativa subsp. japonica GN=SODA PE=2 SV=2
Length = 231

Score = 33.1 bits (74), Expect = 0.80
Identities = 20/58 (34%), Positives = 26/58 (44%)
Frame = +3

Query: 48 WAVSIIF*HISSLCFSISAYG*VIHLCSWVWLFVDLASYAFKSASNCSFTFSANSDPL 221
WA+ F +L +SA G + WVWL +D K A S +AN DPL
Sbjct: 127 WAIDEDFGSFEALVKKMSAEGAALQGSGWVWLALD------KEAKKLSVETTANQDPL 178


>sp|P10587|MYH11_CHICK Myosin-11 OS=Gallus gallus GN=MYH11 PE=1 SV=4
Length = 1979

Score = 33.1 bits (74), Expect = 0.80
Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 9/121 (7%)
Frame = -3

Query: 370 RREREKTALSEELKHTKDRLERLE-DLASL-SSHTAATIVPKAIVEPRSAGARGSLLAEK 197
R+E E A EEL+ TK+R ++ E +L L HT + E A AE+
Sbjct: 855 RQEEEMQAKDEELQRTKERQQKAEAELKELEQKHTQLCEEKNLLQEKLQAETELYAEAEE 914

Query: 196 V-------NEQLEALLKAYEARSTNNQTQEQRWMTYPYAEIEKQRLEMCQKMIETAQSLI 38
+ ++LE +L EAR + + Q +++ ++ +M Q+M++ + L
Sbjct: 915 MRVRLAAKKQELEEILHEMEARIEEEEERSQ--------QLQAEKKKMQQQMLDLEEQLE 966

Query: 37 E 35
E
Sbjct: 967 E 967


>sp|Q8N9E0|F133A_HUMAN Protein FAM133A OS=Homo sapiens GN=FAM133A
PE=2 SV=1
Length = 248

Score = 33.1 bits (74), Expect = 0.80
Identities = 23/79 (29%), Positives = 44/79 (55%)
Frame = -3

Query: 517 SNTYSRSDTSPSSKNDE*THN*RAKNRCPKFKYEKSKTHLES*KGAYEARREREKTALSE 338
S++ S SD+S SS + E + K R K +K++++ S +E+ E +++ +
Sbjct: 105 SSSSSSSDSSSSSSDSEDEEKKQGKRR----KKKKNRSYKSSQSSTHESESESKESV--K 158

Query: 337 ELKHTKDRLERLEDLASLS 281
+ K +KD E+ +D+ SLS
Sbjct: 159 KKKKSKDETEKEKDVRSLS 177


>sp|Q5ZL35|ARGL1_CHICK Arginine and glutamate-rich protein 1
OS=Gallus gallus GN=ARGLU1 PE=2 SV=1
Length = 276

Score = 33.1 bits (74), Expect = 0.80
Identities = 47/195 (24%), Positives = 79/195 (40%), Gaps = 44/195 (22%)
Frame = -3

Query: 517 SNTYSRSDTSPSSKNDE*THN*RAKNRCPKFKY------------EKSKTHLES*KGAYE 374
S + SRS+T+PSS+ D RA + + EK K E K +E
Sbjct: 55 SRSRSRSNTAPSSRRDRERERERASSPPDRIDIFGRTVSKRSSLDEKQKREEEEKKAEFE 114

Query: 373 ARRE-----------REKTA----------LSEELKHTKDRLERLEDLASLSSHTAATIV 257
+R+ E+TA + EEL+ KD +ER E L + A I+
Sbjct: 115 RQRKIRQQEIEEKLIEEETARRVEELVAKRVEEELEKRKDEIER-EVLRRVEE--AKRIM 171

Query: 256 PKAIVEPRSAGARGSLLAEKV--------NEQLEALLKAYEARSTNNQ---TQEQRWMTY 110
K ++E + L A+K E+LE +L+ + Q +EQ +
Sbjct: 172 EKQLLEELERQRQAELAAQKAREEEERAKREELERILEENNRKIAEAQAKLAEEQLKIVE 231

Query: 109 PYAEIEKQRLEMCQK 65
+I ++R+++ Q+
Sbjct: 232 EQRKIHEERMKLEQE 246


>sp|Q9YCB6|RGYR1_AERPE Reverse gyrase 1 OS=Aeropyrum pernix GN=rgy1
PE=3 SV=2
Length = 1370

Score = 32.7 bits (73), Expect = 1.0
Identities = 20/57 (35%), Positives = 30/57 (52%), Gaps = 1/57 (1%)
Frame = -3

Query: 385 GAYEARREREKTALSEELKHTKDRLERLE-DLASLSSHTAATIVPKAIVEPRSAGAR 218
G +++RE + ++L K RLERLE ++ + TA+ IV A PR A R
Sbjct: 264 GLLQSQREEVREEARKKLLEVKRRLERLEAEIEARRGRTASLIVSSATGRPRGARVR 320


>sp|Q8BL66|EEA1_MOUSE Early endosome antigen 1 OS=Mus musculus GN=Eea1
PE=2 SV=2
Length = 1411

Score = 32.3 bits (72), Expect = 1.4
Identities = 25/87 (28%), Positives = 43/87 (49%), Gaps = 2/87 (2%)
Frame = -3

Query: 376 EARREREKTALSEELKHTKDRLERLEDLASLSSHTAATIVPKAIVEPRSAGARGSLLAEK 197
+ R+E+E T L+EELK K E ++++ +L I K ++ R + +L EK
Sbjct: 1133 KCRQEKEITKLNEELKSHKQ--ESIKEITNLKDAKQLLIQQKLELQGRVDSLKAALEQEK 1190

Query: 196 VNEQL--EALLKAYEARSTNNQTQEQR 122
++QL E + K E R +E +
Sbjct: 1191 ESQQLMREQVKKEEEKRKEEFSEKEAK 1217


>sp|Q15075|EEA1_HUMAN Early endosome antigen 1 OS=Homo sapiens GN=EEA1
PE=1 SV=1
Length = 1411

Score = 32.3 bits (72), Expect = 1.4
Identities = 19/65 (29%), Positives = 37/65 (56%)
Frame = -3

Query: 376 EARREREKTALSEELKHTKDRLERLEDLASLSSHTAATIVPKAIVEPRSAGARGSLLAEK 197
+ R+E+E T L+EELK K LE ++++ +L I K ++ ++ + ++ EK
Sbjct: 1133 KCRQEKEITKLNEELKSHK--LESIKEITNLKDAKQLLIQQKLELQGKADSLKAAVEQEK 1190

Query: 196 VNEQL 182
N+Q+
Sbjct: 1191 RNQQI 1195


tr_hit_id A0DW68
Definition tr|A0DW68|A0DW68_PARTE Chromosome undetermined scaffold_66, whole genome shotgun sequence OS=Paramecium tetraurelia
Align length 128
Score (bit) 39.3
E-value 0.12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912729|Adiantum capillus-veneris mRNA, clone:
YMU001_000022_C01.
(519 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A0DW68|A0DW68_PARTE Chromosome undetermined scaffold_66, whol... 39 0.12
tr|B5X415|B5X415_SALSA Tripartite motif-containing protein 16 OS... 39 0.15
tr|B5X4U4|B5X4U4_SALSA Tripartite motif-containing protein 16 OS... 39 0.20
tr|Q9LAX6|Q9LAX6_STRPN PspA (Fragment) OS=Streptococcus pneumoni... 38 0.26
tr|B4PYH2|B4PYH2_DROYA GE17882 OS=Drosophila yakuba GN=GE17882 P... 38 0.26
tr|B5XBH9|B5XBH9_SALSA Tripartite motif-containing protein 25 OS... 38 0.35
tr|B6N2K3|B6N2K3_BRAFL Putative uncharacterized protein OS=Branc... 38 0.35
tr|B6N2J1|B6N2J1_BRAFL Putative uncharacterized protein OS=Branc... 38 0.35
tr|B1N1C6|B1N1C6_MELGA BG-like antigen 2 OS=Meleagris gallopavo ... 37 0.59
tr|B6KT64|B6KT64_TOXGO Putative uncharacterized protein OS=Toxop... 37 0.59
tr|O58021|O58021_PYRHO Putative uncharacterized protein PH0283 O... 37 0.59
tr|Q6T2D7|Q6T2D7_TRYCR Tcr300 OS=Trypanosoma cruzi PE=4 SV=1 37 0.77
tr|A7S3P1|A7S3P1_NEMVE Predicted protein OS=Nematostella vectens... 37 0.77
tr|B1AKD8|B1AKD8_HUMAN Ciliary rootlet coiled-coil, rootletin (F... 37 0.77
tr|A1L0S9|A1L0S9_HUMAN CROCC protein (Fragment) OS=Homo sapiens ... 37 0.77
tr|A1L0S8|A1L0S8_HUMAN CROCC protein (Fragment) OS=Homo sapiens ... 37 0.77
tr|Q1YQ56|Q1YQ56_9GAMM Biopolymer transport protein TolA OS=gamm... 36 1.0
tr|B6KKT3|B6KKT3_TOXGO Putative uncharacterized protein OS=Toxop... 36 1.0
tr|A8X286|A8X286_CAEBR Putative uncharacterized protein OS=Caeno... 36 1.0
tr|Q7PML3|Q7PML3_ANOGA AGAP003925-PA OS=Anopheles gambiae GN=AGA... 36 1.3
tr|Q7RZX0|Q7RZX0_NEUCR Putative uncharacterized protein OS=Neuro... 36 1.3
tr|Q57EX7|Q57EX7_BRUAB ATP synthase B chain OS=Brucella abortus ... 35 1.7
tr|Q2YMC4|Q2YMC4_BRUA2 ATP synthase B chain OS=Brucella abortus ... 35 1.7
tr|B2S9N1|B2S9N1_BRUA1 H+-transporting two-sector ATPase, B/B' s... 35 1.7
tr|B8ERU6|B8ERU6_METSI Capsule polysaccharide export protein-lik... 35 1.7
tr|Q9VR99|Q9VR99_DROME Cactin OS=Drosophila melanogaster GN=cact... 35 1.7
tr|Q4Q843|Q4Q843_LEIMA Glycoprotein 96-92, putative OS=Leishmani... 35 1.7
tr|B6H4G2|B6H4G2_PENCH Pc13g08750 protein OS=Penicillium chrysog... 35 1.7
tr|Q1LX02|Q1LX02_DANRE Novel protein similar to vertebrate prote... 35 2.2
tr|Q00TM1|Q00TM1_OSTTA Myosin class II heavy chain (ISS) OS=Ostr... 35 2.2

>tr|A0DW68|A0DW68_PARTE Chromosome undetermined scaffold_66, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00020938001 PE=4 SV=1
Length = 538

Score = 39.3 bits (90), Expect = 0.12
Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 5/128 (3%)
Frame = -3

Query: 451 RAKNRCPKFK-YEKSKTHLES*KGAYEA----RREREKTALSEELKHTKDRLERLEDLAS 287
R++ R +++ +KS+ LE + + E RR RE+ EEL+ ++ R+E+LEDL
Sbjct: 272 RSRERLEQYQDLQKSRERLEDLRRSRERLDDLRRSRERLNQLEELQRSRQRIEQLEDLKK 331

Query: 286 LSSHTAATIVPKAIVEPRSAGARGSLLAEKVNEQLEALLKAYEARSTNNQTQEQRWMTYP 107
A I E R + R + + E L + + R N Q +E R
Sbjct: 332 SRERQA------QIDELRRSRER----LDDLRRSRERLEQLEQERKNNEQLEELRKSRSR 381

Query: 106 YAEIEKQR 83
E++KQR
Sbjct: 382 IEELQKQR 389


>tr|B5X415|B5X415_SALSA Tripartite motif-containing protein 16
OS=Salmo salar GN=TRI16 PE=2 SV=1
Length = 551

Score = 38.9 bits (89), Expect = 0.15
Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 3/123 (2%)
Frame = -3

Query: 361 REKTALSEELKHTKDRLERLEDLASLSSHTAATIVPKAIVEPRSAGARGSLLAEKVNEQL 182
R+++ E+L HT+D + L+ SLSS + ++ +P +V P S ++ E+L
Sbjct: 289 RKRSTELEQLSHTEDHIHFLQSYQSLSSISVSSDLPSIVVRPLQYFGDVSKTVSELREKL 348

Query: 181 EALLKAYEARSTNNQTQEQRWMTYPYAEIEKQRLE-MCQKMIE--TAQSLIENPLGNLQV 11
E LK E + + P + +Q L+ CQ ++ TA +L+ GN +V
Sbjct: 349 EDFLKG-EWTKISTTVNIVEVVLPPEPKTREQLLQYSCQLTLDPNTAYTLLSLSEGNRKV 407

Query: 10 GST 2
T
Sbjct: 408 TYT 410


>tr|B5X4U4|B5X4U4_SALSA Tripartite motif-containing protein 16
OS=Salmo salar GN=TRI16 PE=2 SV=1
Length = 553

Score = 38.5 bits (88), Expect = 0.20
Identities = 33/123 (26%), Positives = 58/123 (47%), Gaps = 3/123 (2%)
Frame = -3

Query: 361 REKTALSEELKHTKDRLERLEDLASLSSHTAATIVPKAIVEPRSAGARGSLLAEKVNEQL 182
R+++ E+L HT+D + L+ SLSS + ++ +P+ +V P S ++ +L
Sbjct: 289 RKRSTELEQLSHTEDHIHFLQSYQSLSSISVSSDLPRIVVRPLQYFGDVSKTVSELRVKL 348

Query: 181 EALLKAYEARSTNNQTQEQRWMTYPYAEIEKQRLE-MCQKMIE--TAQSLIENPLGNLQV 11
E LK E + + P + KQ L+ CQ ++ TA +L+ GN +V
Sbjct: 349 EDFLKG-EWTKISTTVNIVDVLLPPEPKTRKQLLQYSCQLRLDPNTAYTLLSLSKGNRKV 407

Query: 10 GST 2
T
Sbjct: 408 TYT 410


>tr|Q9LAX6|Q9LAX6_STRPN PspA (Fragment) OS=Streptococcus pneumoniae
GN=pspA PE=4 SV=1
Length = 461

Score = 38.1 bits (87), Expect = 0.26
Identities = 39/141 (27%), Positives = 64/141 (45%), Gaps = 3/141 (2%)
Frame = -3

Query: 424 KYEKSKTHLES*KGAYEARREREKTA---LSEELKHTKDRLERLEDLASLSSHTAATIVP 254
KYE++K ++ K YE +++ + A E+ K T+D+ + ++ + A V
Sbjct: 46 KYEEAKAKADTAKKDYETAKKKAEDAQKKYDEDQKKTEDKAKAVKKVDE-ERQKANLAVQ 104

Query: 253 KAIVEPRSAGARGSLLAEKVNEQLEALLKAYEARSTNNQTQEQRWMTYPYAEIEKQRLEM 74
KA VE R A + S AEK E EA K EA N+ Q + KQ+ E
Sbjct: 105 KAYVEYREAKDKAS--AEKKIE--EAKRKQKEANKKFNEEQAKVVPEAKELAATKQKAEK 160

Query: 73 CQKMIETAQSLIENPLGNLQV 11
+K E A+ + + ++V
Sbjct: 161 AKKDAEVAKEKYDKAVQEVEV 181


>tr|B4PYH2|B4PYH2_DROYA GE17882 OS=Drosophila yakuba GN=GE17882 PE=4
SV=1
Length = 630

Score = 38.1 bits (87), Expect = 0.26
Identities = 39/155 (25%), Positives = 72/155 (46%), Gaps = 5/155 (3%)
Frame = -3

Query: 451 RAKNRCPKFKYEKSKTHLES*KGAYEARREREKTALSEELKHTKDRLERLEDLASLSSHT 272
R ++R + + EK + H + + RRE+EK ++ + K R R +S SS T
Sbjct: 29 RNRDRDREREREKERDHRDYRDKERDQRREKEKDKNRDKKREHKSRRRRSSSSSSSSSST 88

Query: 271 AATIV--PKAIVEPRSAGARGSLLAEKVNEQLEALLKAYEARSTNNQTQEQ---RWMTYP 107
++T P++ + S +L A ++ EQ + K E ++ N+T E+ R +
Sbjct: 89 SSTAAGGPRSPLTKSSMKLLQTLEARRLVEQKDRQRKKEELKA--NETPEEKRARRLREK 146

Query: 106 YAEIEKQRLEMCQKMIETAQSLIENPLGNLQVGST 2
A+ +++R M S +NP G+ + ST
Sbjct: 147 QAKEQRRRERMGWDNEYQTYSNEDNPFGDSNLTST 181


>tr|B5XBH9|B5XBH9_SALSA Tripartite motif-containing protein 25
OS=Salmo salar GN=TRI25 PE=2 SV=1
Length = 380

Score = 37.7 bits (86), Expect = 0.35
Identities = 20/67 (29%), Positives = 35/67 (52%)
Frame = -3

Query: 361 REKTALSEELKHTKDRLERLEDLASLSSHTAATIVPKAIVEPRSAGARGSLLAEKVNEQL 182
R+++ E+L HT+D + L+ SLSS + ++ +P +V P S ++ E+L
Sbjct: 289 RKRSTELEQLSHTEDHIHFLQSYQSLSSISVSSDLPSIVVRPLQFFGDVSKTVSELREKL 348

Query: 181 EALLKAY 161
E L Y
Sbjct: 349 EDFLNLY 355


>tr|B6N2K3|B6N2K3_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_125644 PE=4 SV=1
Length = 450

Score = 37.7 bits (86), Expect = 0.35
Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 8/93 (8%)
Frame = -3

Query: 319 DRLERLEDLASLSSHTAATIVPKAIVEPRSAGARGSL--------LAEKVNEQLEALLKA 164
D ++ + L L H + IV + R A G L V++ L+AL KA
Sbjct: 334 DNIDVIRILVKLDGHESWAIVENVFISGRYYSADGHYSYVDYLEGLNLGVSKDLDALHKA 393

Query: 163 YEARSTNNQTQEQRWMTYPYAEIEKQRLEMCQK 65
R T+N E+ W +Y E+ + RLEM K
Sbjct: 394 RFERKTDNAIAEKNWRSY---EVRRYRLEMRHK 423


>tr|B6N2J1|B6N2J1_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_125639 PE=4 SV=1
Length = 585

Score = 37.7 bits (86), Expect = 0.35
Identities = 28/93 (30%), Positives = 41/93 (44%), Gaps = 8/93 (8%)
Frame = -3

Query: 319 DRLERLEDLASLSSHTAATIVPKAIVEPRSAGARGSL--------LAEKVNEQLEALLKA 164
D ++ + L L H + IV + R A G L V++ L+AL KA
Sbjct: 332 DNIDVIRILVKLDGHESWAIVENVFISGRYYSADGHYSYVDYLEGLNLGVSKDLDALHKA 391

Query: 163 YEARSTNNQTQEQRWMTYPYAEIEKQRLEMCQK 65
R T+N E+ W +Y E+ + RLEM K
Sbjct: 392 RFERKTDNAIAEKNWRSY---EVRRYRLEMRHK 421


>tr|B1N1C6|B1N1C6_MELGA BG-like antigen 2 OS=Meleagris gallopavo
GN=BG2 PE=4 SV=1
Length = 359

Score = 37.0 bits (84), Expect = 0.59
Identities = 34/125 (27%), Positives = 60/125 (48%), Gaps = 18/125 (14%)
Frame = -3

Query: 361 REKTALSEELKHTKDRLERLEDLASLSSHTAATIVPKA--IVEPRSAGARGSLLAEKVNE 188
R++ ALS ELK T +L + A++ + TA ++ +A +VE + +L+ +K +E
Sbjct: 181 RKQVALSRELKRTD---AKLAEQAAVLNFTAGSLKKQAAELVEQTKEVEKKNLVLKKSSE 237

Query: 187 QLEAL-------------LKAYEARSTNNQTQEQRWMTYPYAEIEKQRLEM---CQKMIE 56
+++ LK + TN ++ + E+EKQ E+ C+KM
Sbjct: 238 NIDSTARDLKKQAAELEKLKEKMLKQTNKLEEQTEKLVKENEEVEKQNSELKKNCEKMDF 297

Query: 55 TAQSL 41
TA SL
Sbjct: 298 TAGSL 302


>tr|B6KT64|B6KT64_TOXGO Putative uncharacterized protein OS=Toxoplasma
gondii ME49 GN=TGME49_012880 PE=4 SV=1
Length = 4817

Score = 37.0 bits (84), Expect = 0.59
Identities = 33/96 (34%), Positives = 43/96 (44%), Gaps = 7/96 (7%)
Frame = -3

Query: 385 GAYEARREREKTALSEELKHTKDRLERLE-DLASLSSHTAATIVPKAIVEPRSAGARGSL 209
G A RE E+ AL ELKH KDR++ E A+L+ H A K V+ R +RG
Sbjct: 1995 GEMAANRE-EQEALRGELKHLKDRVDHGEAKAAALTQHLEAAESEKRHVQ-RELESRGEE 2052

Query: 208 LAE------KVNEQLEALLKAYEARSTNNQTQEQRW 119
L + +V L EA NQ+Q W
Sbjct: 2053 LEQLRIAKSRVETDFSRLKMEVEAERERNQSQRTFW 2088