BP912734
Clone id YMU001_000022_C06
Library
Length 488
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000022_C06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTGTTTTTTTTTTTTTATCGCAACCCATATGGTCATTCAACCCACAGCTTCAGGTCCA
TGACATCATTAACAAGTGATTTTGGCTGCTATTGAGTCAGTGTTCTAAGACTTGAAGAGC
ACGTATACAGATTTGACTAGGTTATATTACAAGAGAACATAAGCCTGTACAAGGTCTTGT
TTGTGATCCCAAGGTGTAGGCTCAGAAGGCACTTCTCCTCCACCCTTCAACCATTCTAGC
TCTATTTGAACCACTTTCGTATGCACATTGATGTAAGAGACAACTCTTCGATGGGGCTAG
CTTACCACTATAAAACCACCCCGGCATGAAAGCCACGTTTCCCAATAAAATTTGGCTTAA
TGATCTCCCAGCCATTATCCACACGGTACTGTTCGACTGTTTGTAAGTACTGTTTTCCAG
TATAGCCTCCCAATACATATATGTTGTGCCCAACGGTCACAGCTGATGCATAAGATCTCT
TGCAATTC
■■Homology search results ■■ -
sp_hit_id Q9Y6Y0
Definition sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo sapiens
Align length 38
Score (bit) 40.0
E-value 0.005
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912734|Adiantum capillus-veneris mRNA, clone:
YMU001_000022_C06.
(470 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Ho... 40 0.005
sp|Q9C0H6|KLHL4_HUMAN Kelch-like protein 4 OS=Homo sapiens GN=KL... 39 0.015
sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homol... 38 0.020
sp|Q96PQ7|KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens GN=KL... 38 0.026
sp|Q9NXS3|KLH28_HUMAN Kelch-like protein 28 OS=Homo sapiens GN=K... 38 0.026
sp|Q6JEL3|KLH10_RAT Kelch-like protein 10 OS=Rattus norvegicus G... 38 0.026
sp|Q9D5V2|KLH10_MOUSE Kelch-like protein 10 OS=Mus musculus GN=K... 38 0.026
sp|Q6JEL2|KLH10_HUMAN Kelch-like protein 10 OS=Homo sapiens GN=K... 38 0.026
sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homol... 37 0.044
sp|Q6NRH0|KLH12_XENLA Kelch-like protein 12 OS=Xenopus laevis GN... 36 0.074
sp|Q9CR40|KLH28_MOUSE Kelch-like protein 28 OS=Mus musculus GN=K... 35 0.17
sp|Q8K430|KLH17_RAT Kelch-like protein 17 OS=Rattus norvegicus G... 35 0.17
sp|Q6TDP3|KLH17_MOUSE Kelch-like protein 17 OS=Mus musculus GN=K... 35 0.17
sp|Q8R2H4|KLH12_RAT Kelch-like protein 12 OS=Rattus norvegicus G... 35 0.22
sp|Q8BZM0|KLH12_MOUSE Kelch-like protein 12 OS=Mus musculus GN=K... 35 0.22
sp|Q53G59|KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens GN=K... 35 0.22
sp|Q6TDP4|KLH17_HUMAN Kelch-like protein 17 OS=Homo sapiens GN=K... 34 0.28
sp|Q6GQU2|KLH23_MOUSE Kelch-like protein 23 OS=Mus musculus GN=K... 34 0.37
sp|Q8NBE8|KLH23_HUMAN Kelch-like protein 23 OS=Homo sapiens GN=K... 34 0.37
sp|O94889|KLH18_HUMAN Kelch-like protein 18 OS=Homo sapiens GN=K... 34 0.37
sp|Q5U374|KLH12_DANRE Kelch-like protein 12 OS=Danio rerio GN=kl... 34 0.37
sp|P59280|KLHL8_MOUSE Kelch-like protein 8 OS=Mus musculus GN=Kl... 33 0.48
sp|Q9JI74|KLHL1_MOUSE Kelch-like protein 1 OS=Mus musculus GN=Kl... 33 0.48
sp|Q9NR64|KLHL1_HUMAN Kelch-like protein 1 OS=Homo sapiens GN=KL... 33 0.48
sp|Q4V8F4|RABEK_RAT Rab9 effector protein with Kelch motifs OS=R... 33 0.63
sp|Q5EA50|RABEK_BOVIN Rab9 effector protein with Kelch motifs OS... 33 0.63
sp|Q91XA8|KLD8A_MOUSE Kelch domain-containing protein 8A OS=Mus ... 33 0.63
sp|Q7ZVQ8|NS1BB_DANRE Influenza virus NS1A-binding protein homol... 33 0.82
sp|Q5REP9|KLHL3_PONAB Kelch-like protein 3 OS=Pongo abelii GN=KL... 33 0.82
sp|Q9UH77|KLHL3_HUMAN Kelch-like protein 3 OS=Homo sapiens GN=KL... 33 0.82

>sp|Q9Y6Y0|NS1BP_HUMAN Influenza virus NS1A-binding protein OS=Homo
sapiens GN=IVNS1ABP PE=1 SV=3
Length = 642

Score = 40.0 bits (92), Expect = 0.005
Identities = 18/38 (47%), Positives = 25/38 (65%), Gaps = 1/38 (2%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVD-NGW 350
RS A TVG+ IY +GG+ G ++L TVE Y ++ N W
Sbjct: 596 RSNAGIATVGNTIYAVGGFDGNEFLNTVEVYNLESNEW 633



Score = 37.7 bits (86), Expect = 0.026
Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
Frame = -2

Query: 469 NCKRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVDNG-WEIIKPNFIGKRGFHAGVVL 293
N +R ++ +G +Y++GG L TVE+Y +N W +I P + +RG AGV +
Sbjct: 499 NIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRG--AGVAV 556


>sp|Q9C0H6|KLHL4_HUMAN Kelch-like protein 4 OS=Homo sapiens GN=KLHL4
PE=2 SV=2
Length = 718

Score = 38.5 bits (88), Expect = 0.015
Identities = 20/50 (40%), Positives = 26/50 (52%), Gaps = 1/50 (2%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVD-NGWEIIKPNFIGKRG 314
R + +G +YV+GGY G YL TVE Y N W+ P IG+ G
Sbjct: 660 RDAVAVCPLGDKLYVVGGYDGHTYLNTVESYDAQRNEWKEEVPVNIGRAG 709


>sp|Q920Q8|NS1BP_MOUSE Influenza virus NS1A-binding protein homolog
OS=Mus musculus GN=Ivns1abp PE=1 SV=2
Length = 642

Score = 38.1 bits (87), Expect = 0.020
Identities = 18/38 (47%), Positives = 23/38 (60%), Gaps = 1/38 (2%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQYLQTVEQYR-VDNGW 350
RS A TVG+ IY +GG+ G ++L TVE Y N W
Sbjct: 596 RSNAGITTVGNTIYAVGGFDGNEFLNTVEVYNPQSNEW 633



Score = 37.7 bits (86), Expect = 0.026
Identities = 20/60 (33%), Positives = 33/60 (55%), Gaps = 1/60 (1%)
Frame = -2

Query: 469 NCKRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVDNG-WEIIKPNFIGKRGFHAGVVL 293
N +R ++ +G +Y++GG L TVE+Y +N W +I P + +RG AGV +
Sbjct: 499 NIRRHQSAVCELGGYLYIIGGAESWNCLNTVERYNPENNTWTLIAPMNVARRG--AGVAV 556


>sp|Q96PQ7|KLHL5_HUMAN Kelch-like protein 5 OS=Homo sapiens GN=KLHL5
PE=2 SV=3
Length = 755

Score = 37.7 bits (86), Expect = 0.026
Identities = 18/50 (36%), Positives = 25/50 (50%), Gaps = 1/50 (2%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVD-NGWEIIKPNFIGKRG 314
R +G +Y +GGY G+ YL TVE Y N W + P +G+ G
Sbjct: 698 RDAVGVCLLGDKLYAVGGYDGQAYLNTVEAYDPQTNEWTQVAPLCLGRAG 747


>sp|Q9NXS3|KLH28_HUMAN Kelch-like protein 28 OS=Homo sapiens
GN=KLHL28 PE=2 SV=2
Length = 571

Score = 37.7 bits (86), Expect = 0.026
Identities = 21/59 (35%), Positives = 30/59 (50%), Gaps = 1/59 (1%)
Frame = -2

Query: 469 NCKRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVD-NGWEIIKPNFIGKRGFHAGVV 296
N RS V + +Y LGGY G+ YLQ+VE+Y W+ + P + F A V+
Sbjct: 373 NESRSTLGVVVLAGELYALGGYDGQSYLQSVEKYIPKIRKWQPVAPMTTTRSCFAAAVL 431



Score = 32.7 bits (73), Expect = 0.82
Identities = 12/31 (38%), Positives = 21/31 (67%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQYLQTVEQY 368
R+ A + + +YV+GG++G YL TV++Y
Sbjct: 516 RTGVGAAVIDNYLYVVGGHSGSSYLNTVQKY 546



Score = 30.4 bits (67), Expect = 4.1
Identities = 14/44 (31%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
Frame = -2

Query: 424 IYVLGGYTGKQYLQTVEQYRV-DNGWEIIKPNFIGKRGFHAGVV 296
I+V+GG+ G +L ++E+Y N W + +P + G A V+
Sbjct: 481 IFVVGGHNGVSHLSSIERYDPHQNQWTVCRPMKEPRTGVGAAVI 524


>sp|Q6JEL3|KLH10_RAT Kelch-like protein 10 OS=Rattus norvegicus
GN=Klhl10 PE=2 SV=1
Length = 608

Score = 37.7 bits (86), Expect = 0.026
Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVD-NGWEIIKP 335
+RS ASA T+ +Y+ GG+ G + L T E Y + N W +I P
Sbjct: 422 QRSDASATTLYGKVYICGGFNGNECLFTAEVYNTESNQWTVIAP 465



Score = 35.0 bits (79), Expect = 0.17
Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVD-NGWEIIKP 335
+R Y S + + IY +GG+ G L T E+Y + N W +I P
Sbjct: 375 RRCYVSVTVLSNFIYAMGGFDGYVRLNTAERYEPETNQWTLIAP 418


>sp|Q9D5V2|KLH10_MOUSE Kelch-like protein 10 OS=Mus musculus
GN=Klhl10 PE=2 SV=1
Length = 608

Score = 37.7 bits (86), Expect = 0.026
Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVD-NGWEIIKP 335
+RS ASA T+ +Y+ GG+ G + L T E Y + N W +I P
Sbjct: 422 QRSDASATTLYGKVYICGGFNGNECLFTAEVYNTESNQWTVIAP 465



Score = 35.0 bits (79), Expect = 0.17
Identities = 16/44 (36%), Positives = 24/44 (54%), Gaps = 1/44 (2%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVD-NGWEIIKP 335
+R Y S + + IY +GG+ G L T E+Y + N W +I P
Sbjct: 375 RRCYVSVTVLSNFIYAMGGFDGYVRLNTAERYEPETNQWTLIAP 418


>sp|Q6JEL2|KLH10_HUMAN Kelch-like protein 10 OS=Homo sapiens
GN=KLHL10 PE=2 SV=1
Length = 608

Score = 37.7 bits (86), Expect = 0.026
Identities = 18/44 (40%), Positives = 26/44 (59%), Gaps = 1/44 (2%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVD-NGWEIIKP 335
+RS ASA T+ +Y+ GG+ G + L T E Y + N W +I P
Sbjct: 422 QRSDASATTLYGKVYICGGFNGNECLFTAEVYNTESNQWTVIAP 465



Score = 37.4 bits (85), Expect = 0.033
Identities = 17/44 (38%), Positives = 25/44 (56%), Gaps = 1/44 (2%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVD-NGWEIIKP 335
+R Y S +G+ IY +GG+ G L T E+Y + N W +I P
Sbjct: 375 RRCYVSVTVLGNFIYAMGGFDGYVRLNTAERYEPETNQWTLIAP 418


>sp|Q6DFU2|NS1BP_XENLA Influenza virus NS1A-binding protein homolog
OS=Xenopus laevis GN=ivns1abp PE=2 SV=1
Length = 638

Score = 37.0 bits (84), Expect = 0.044
Identities = 16/31 (51%), Positives = 20/31 (64%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQYLQTVEQY 368
RS A V VG+ IY GG+ G ++L TVE Y
Sbjct: 592 RSNAGVVAVGNQIYAAGGFDGNEFLNTVEVY 622



Score = 34.3 bits (77), Expect = 0.28
Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
Frame = -2

Query: 469 NCKRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVDNG-WEIIKPNFIGKRG 314
N +R + +G+ IY++GG L +VE Y N W ++ P + +RG
Sbjct: 495 NIRRHQPAVCELGNKIYIIGGAESWNCLNSVECYNPQNDTWTLVAPMNVARRG 547


>sp|Q6NRH0|KLH12_XENLA Kelch-like protein 12 OS=Xenopus laevis
GN=klhl12 PE=2 SV=2
Length = 564

Score = 36.2 bits (82), Expect = 0.074
Identities = 14/30 (46%), Positives = 21/30 (70%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVE 374
KR Y + V++G +YV+GGY G+ L +VE
Sbjct: 314 KRRYVATVSLGDRVYVIGGYDGRSRLSSVE 343



Score = 32.3 bits (72), Expect = 1.1
Identities = 14/34 (41%), Positives = 21/34 (61%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRV 362
KRS A + +IYV+GG+ G +L +VE Y +
Sbjct: 458 KRSGAGVSLLNDHIYVVGGFDGTAHLSSVEAYNI 491



Score = 32.0 bits (71), Expect = 1.4
Identities = 14/34 (41%), Positives = 21/34 (61%)
Frame = -2

Query: 469 NCKRSYASAVTVGHNIYVLGGYTGKQYLQTVEQY 368
N +R A A T+G IYV GG+ G + ++E+Y
Sbjct: 362 NVRRGLAGATTLGDMIYVSGGFDGSRRHTSMERY 395



Score = 31.6 bits (70), Expect = 1.8
Identities = 22/57 (38%), Positives = 26/57 (45%), Gaps = 1/57 (1%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVDNG-WEIIKPNFIGKRGFHAGVVL 293
R A V IY LGGY G L +VE+Y G W + P + G AGV L
Sbjct: 412 REGAGLVVANGVIYCLGGYDGLNILSSVERYDPHTGHWSHVTPMATKRSG--AGVSL 466


tr_hit_id A7QFG1
Definition tr|A7QFG1|A7QFG1_VITVI Chromosome chr8 scaffold_88, whole genome shotgun sequence OS=Vitis vinifera
Align length 59
Score (bit) 49.3
E-value 0.0001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912734|Adiantum capillus-veneris mRNA, clone:
YMU001_000022_C06.
(470 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QFG1|A7QFG1_VITVI Chromosome chr8 scaffold_88, whole genome... 49 1e-04
tr|A7Q3Q7|A7Q3Q7_VITVI Chromosome chr13 scaffold_48, whole genom... 47 4e-04
tr|Q0DKG6|Q0DKG6_ORYSJ Os05g0164900 protein OS=Oryza sativa subs... 46 8e-04
tr|B8AYF5|B8AYF5_ORYSI Putative uncharacterized protein OS=Oryza... 46 8e-04
tr|A3B0B5|A3B0B5_ORYSJ Putative uncharacterized protein OS=Oryza... 46 8e-04
tr|Q9M010|Q9M010_ARATH Putative uncharacterized protein F7A7_180... 45 0.002
tr|Q7XB90|Q7XB90_ORYSJ KEAP1 OS=Oryza sativa subsp. japonica PE=... 45 0.002
tr|Q5VQH0|Q5VQH0_ORYSJ cDNA clone:J013070N02, full insert sequen... 45 0.002
tr|A2ZPM4|A2ZPM4_ORYSJ Putative uncharacterized protein OS=Oryza... 45 0.002
tr|A2WL21|A2WL21_ORYSI Putative uncharacterized protein OS=Oryza... 45 0.002
tr|A0BSL8|A0BSL8_PARTE Chromosome undetermined scaffold_125, who... 45 0.002
tr|B4JQ27|B4JQ27_DROGR GH13286 OS=Drosophila grimshawi GN=GH1328... 43 0.009
tr|B3MX26|B3MX26_DROAN GF16096 OS=Drosophila ananassae GN=GF1609... 43 0.009
tr|A0DAQ2|A0DAQ2_PARTE Chromosome undetermined scaffold_43, whol... 43 0.009
tr|A0CGL9|A0CGL9_PARTE Chromosome undetermined scaffold_18, whol... 42 0.012
tr|B7Q819|B7Q819_IXOSC Putative uncharacterized protein OS=Ixode... 42 0.015
tr|B4LQP6|B4LQP6_DROVI GJ14979 OS=Drosophila virilis GN=GJ14979 ... 42 0.015
tr|B4KFF4|B4KFF4_DROMO GI17478 OS=Drosophila mojavensis GN=GI174... 42 0.015
tr|Q6GKZ1|Q6GKZ1_DROME CG12423, isoform A OS=Drosophila melanoga... 42 0.020
tr|B4NVB2|B4NVB2_DROSI GD20583 OS=Drosophila simulans GN=GD20583... 42 0.020
tr|B4NV94|B4NV94_DROSI GD20976 OS=Drosophila simulans GN=GD20976... 42 0.020
tr|B4M5J0|B4M5J0_DROVI GJ10590 OS=Drosophila virilis GN=GJ10590 ... 42 0.020
tr|B4IVI3|B4IVI3_DROYA GE14947 OS=Drosophila yakuba GN=GE14947 P... 42 0.020
tr|B4IMD9|B4IMD9_DROSE GM10086 OS=Drosophila sechellia GN=GM1008... 42 0.020
tr|B3NKG2|B3NKG2_DROER GG21409 OS=Drosophila erecta GN=GG21409 P... 42 0.020
tr|A8QI36|A8QI36_DROME CG17925 (Fragment) OS=Drosophila melanoga... 42 0.020
tr|A7RP55|A7RP55_NEMVE Predicted protein OS=Nematostella vectens... 42 0.020
tr|Q4SHR9|Q4SHR9_TETNG Chromosome 5 SCAF14581, whole genome shot... 41 0.026
tr|B6NWI4|B6NWI4_BRAFL Putative uncharacterized protein OS=Branc... 41 0.034
tr|B6NVJ8|B6NVJ8_BRAFL Putative uncharacterized protein OS=Branc... 41 0.034

>tr|A7QFG1|A7QFG1_VITVI Chromosome chr8 scaffold_88, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00037409001
PE=4 SV=1
Length = 633

Score = 49.3 bits (116), Expect = 1e-04
Identities = 25/59 (42%), Positives = 34/59 (57%), Gaps = 1/59 (1%)
Frame = -2

Query: 469 NCKRSYASAVTVGHNIYVLGGYT-GKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVV 296
N R Y++A V +IYV+GG G+ + TVE Y GW +IK IGKR F + +V
Sbjct: 574 NQSRGYSAAAVVNKSIYVIGGVEDGENVVGTVELYEEGEGWRVIKQTAIGKRCFASAIV 632



Score = 37.4 bits (85), Expect = 0.38
Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 1/57 (1%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQYLQTVEQYR-VDNGWEIIKPNFIGKRGFHAGVVL 293
RSYAS + +Y+ GG G ++ TVE Y V N W + P ++G AG L
Sbjct: 389 RSYASVAVLNGELYIFGGGNGSEWYDTVEAYNLVSNEWTLRAP-LNKEKGSLAGATL 444



Score = 33.1 bits (74), Expect = 7.1
Identities = 22/58 (37%), Positives = 29/58 (50%), Gaps = 1/58 (1%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRV-DNGWEIIKPNFIGKRGFHAGVVL 293
KR A + +Y +GGY GK YL +VE+ ++ W I KRG H VVL
Sbjct: 482 KRFALGAAELNGVLYAVGGYDGKDYLNSVERLDPREHSWTRI-GGMKTKRGSHTVVVL 538


>tr|A7Q3Q7|A7Q3Q7_VITVI Chromosome chr13 scaffold_48, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029377001
PE=4 SV=1
Length = 675

Score = 47.4 bits (111), Expect = 4e-04
Identities = 24/60 (40%), Positives = 35/60 (58%), Gaps = 1/60 (1%)
Frame = -2

Query: 469 NCKRSYASAVTVGHNIYVLGGYT-GKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
N R Y+ AV +G +IYV+GG ++ L TVE Y+ +GW + +GKR F + VL
Sbjct: 616 NDPRGYSGAVVLGESIYVIGGLKDNEEILDTVECYKEGHGWLVTSLKAVGKRCFFSATVL 675



Score = 36.6 bits (83), Expect = 0.65
Identities = 18/56 (32%), Positives = 27/56 (48%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
RSYAS + +Y+ GG G + VE Y + +P+ ++G AGV L
Sbjct: 431 RSYASVAKLDGELYIFGGVDGNSWYNIVESYNPMTDQWVSRPSLTQRKGSLAGVSL 486


>tr|Q0DKG6|Q0DKG6_ORYSJ Os05g0164900 protein OS=Oryza sativa subsp.
japonica GN=Os05g0164900 PE=4 SV=1
Length = 1049

Score = 46.2 bits (108), Expect = 8e-04
Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%)
Frame = -2

Query: 469 NCKRSYASAVTVGHNIYVLGG-YTGKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
N R YAS VT+G N++V+GG + ++++ +VE Y V GW + + IG R F + V+
Sbjct: 990 NFPRGYASTVTLGDNVFVIGGLQSSEKFMDSVEVYNVKCGWSVPGFSSIGVRCFASAAVV 1049


>tr|B8AYF5|B8AYF5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_18588 PE=4 SV=1
Length = 1124

Score = 46.2 bits (108), Expect = 8e-04
Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%)
Frame = -2

Query: 469 NCKRSYASAVTVGHNIYVLGG-YTGKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
N R YAS VT+G N++V+GG + ++++ +VE Y V GW + + IG R F + V+
Sbjct: 1065 NFPRGYASTVTLGDNVFVIGGLQSSEKFMDSVEVYNVKCGWSVPGFSSIGVRCFASAAVV 1124



Score = 32.7 bits (73), Expect = 9.3
Identities = 18/57 (31%), Positives = 26/57 (45%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
+R A + IY GG+ G YLQ+ E+Y G+ P+ +RG H L
Sbjct: 973 RRFALGAAEMNSVIYATGGFDGFSYLQSAERYDPREGFWARLPSMNVRRGCHTVAAL 1029


>tr|A3B0B5|A3B0B5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_016487 PE=4 SV=1
Length = 1084

Score = 46.2 bits (108), Expect = 8e-04
Identities = 23/60 (38%), Positives = 37/60 (61%), Gaps = 1/60 (1%)
Frame = -2

Query: 469 NCKRSYASAVTVGHNIYVLGG-YTGKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
N R YAS VT+G N++V+GG + ++++ +VE Y V GW + + IG R F + V+
Sbjct: 1025 NFPRGYASTVTLGDNVFVIGGLQSSEKFMDSVEVYNVKCGWSVPGFSSIGVRCFASAAVV 1084


>tr|Q9M010|Q9M010_ARATH Putative uncharacterized protein F7A7_180
OS=Arabidopsis thaliana GN=F7A7_180 PE=4 SV=1
Length = 621

Score = 44.7 bits (104), Expect = 0.002
Identities = 22/58 (37%), Positives = 35/58 (60%), Gaps = 2/58 (3%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQ--YLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
R Y++ V +IYV+GGY G++ L TVE ++ GW+ + + IG+R F + V L
Sbjct: 564 RGYSAVAVVKDSIYVIGGYKGEEDDILDTVECFKEGEGWKNVPSSSIGRRCFLSAVAL 621



Score = 35.4 bits (80), Expect = 1.4
Identities = 21/58 (36%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
Frame = -2

Query: 463 KRSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRV-DNGWEIIKPNFIGKRGFHAGVVL 293
+R ++V +IY +GGY GK+YL T E++ ++ W I + +RG H+ VVL
Sbjct: 469 ERFAVASVEHKSSIYAVGGYDGKEYLNTAERFDPREHSWMNI-ASMKSRRGCHSLVVL 525


>tr|Q7XB90|Q7XB90_ORYSJ KEAP1 OS=Oryza sativa subsp. japonica PE=2
SV=1
Length = 697

Score = 44.7 bits (104), Expect = 0.002
Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGY-TGKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
R++ AVT+ N Y++GG + ++Y++TVE Y+ GW I GKR F V +
Sbjct: 641 RAHGCAVTLDGNAYLIGGIQSSEEYVETVEVYKEGQGWSISGSKAFGKRAFACAVAI 697


>tr|Q5VQH0|Q5VQH0_ORYSJ cDNA clone:J013070N02, full insert sequence
OS=Oryza sativa subsp. japonica GN=P0701D05.9-1 PE=2
SV=1
Length = 700

Score = 44.7 bits (104), Expect = 0.002
Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGY-TGKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
R++ AVT+ N Y++GG + ++Y++TVE Y+ GW I GKR F V +
Sbjct: 644 RAHGCAVTLDGNAYLIGGIQSSEEYVETVEVYKEGQGWSISGSKAFGKRAFACAVAI 700



Score = 40.4 bits (93), Expect = 0.045
Identities = 21/56 (37%), Positives = 30/56 (53%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGYTGKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
R +A + +YV+GGY G YLQ+ E+Y G+ P +RG H+ VVL
Sbjct: 550 RCAPAAAELNGVLYVIGGYDGNMYLQSAERYDPREGFWTQLPRMRTRRGSHSVVVL 605


>tr|A2ZPM4|A2ZPM4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_000496 PE=4 SV=1
Length = 676

Score = 44.7 bits (104), Expect = 0.002
Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGY-TGKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
R++ AVT+ N Y++GG + ++Y++TVE Y+ GW I GKR F V +
Sbjct: 620 RAHGCAVTLDGNAYLIGGIQSSEEYVETVEVYKEGQGWSISGSKAFGKRAFACAVAI 676


>tr|A2WL21|A2WL21_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_00533 PE=4 SV=1
Length = 697

Score = 44.7 bits (104), Expect = 0.002
Identities = 21/57 (36%), Positives = 33/57 (57%), Gaps = 1/57 (1%)
Frame = -2

Query: 460 RSYASAVTVGHNIYVLGGY-TGKQYLQTVEQYRVDNGWEIIKPNFIGKRGFHAGVVL 293
R++ AVT+ N Y++GG + ++Y++TVE Y+ GW I GKR F V +
Sbjct: 641 RAHGCAVTLDGNAYLIGGIQSSEEYVETVEVYKEGQGWSISGSKAFGKRAFACAVAI 697