BP912787
Clone id YMU001_000022_H03
Library
Length 548
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000022_H03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCTGCTAGCTAGAGCAATAGTCAATTAAACATGCAATTTCTGCATGAGAAAAGACACGAA
CACTGATATCCAAAAAGCAGCTGTACACAGGCACCAAAGTTCCACTGATGAAAGCGTGTG
TGCCCGGAAGAAAAGGACCTTATGCAAGTATTAGAGCTTTGGCCTTTGCTTCACTCTTCA
ATTCATGGCATATTTCTGAGTCCATGCTCTTGCTGTCTCCTCATACCTTGGCCTCTGATT
TTGGTAGATGTGCGCAATCTCTGGCACAAGAGGATCGTCGGGGTTTGGGCCGGTCAGAAG
TGAGCAAATTGACAAGAGGACCTTTGAGATTGTCAGCGCTGGGCTCCACTGTTCCTTCAA
TATATCCAAGCATATGCTGCCATTTGAGTTGATGTTGGGGTGGTATACCTTGGTCGAGAA
ATTCACTTTGGGGGGCTTGAATGGGTAGTCAGGGGGGAAGTGAATAGTGACGAAGAAGAC
CCACCCGAGTAGGGGCTATCGCTCGGNCCCATAATAGTAGCTTGCCAGTGGAAGAGATCA
TCGCCCAC
■■Homology search results ■■ -
sp_hit_id P35134
Definition sp|P35134|UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arabidopsis thaliana
Align length 104
Score (bit) 192.0
E-value 1.0e-50
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912787|Adiantum capillus-veneris mRNA, clone:
YMU001_000022_H03.
(548 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P35134|UBC11_ARATH Ubiquitin-conjugating enzyme E2 11 OS=Arab... 192 1e-50
sp|Q9FKT3|UBC30_ARATH Ubiquitin carrier protein E2 30 OS=Arabido... 191 3e-50
sp|Q94F47|UBC28_ARATH Ubiquitin carrier protein E2 28 OS=Arabido... 189 5e-50
sp|P35133|UBC10_ARATH Ubiquitin-conjugating enzyme E2 10 OS=Arab... 189 7e-50
sp|P35131|UBC8_ARATH Ubiquitin-conjugating enzyme E2 8 OS=Arabid... 188 1e-49
sp|P35135|UBC4_SOLLC Ubiquitin-conjugating enzyme E2-17 kDa OS=S... 188 1e-49
sp|P46595|UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4 OS=Schizo... 184 1e-49
sp|P35132|UBC9_ARATH SUMO-conjugating enzyme UBC9 OS=Arabidopsis... 188 2e-49
sp|Q9UVR2|UBC1_MAGGR Ubiquitin-conjugating enzyme E2-16 kDa OS=M... 183 4e-49
sp|O74196|UBC1_COLGL Ubiquitin-conjugating enzyme E2-16 kDa OS=C... 183 6e-49
sp|P15731|UBC4_YEAST Ubiquitin-conjugating enzyme E2 4 OS=Saccha... 182 2e-48
sp|P35129|UBC2_CAEEL Ubiquitin-conjugating enzyme E2 2 OS=Caenor... 178 5e-48
sp|Q9SLE4|UBC29_ARATH Ubiquitin carrier protein E2 29 OS=Arabido... 182 6e-48
sp|Q9Y2X8|UB2D4_HUMAN Ubiquitin-conjugating enzyme E2 D4 OS=Homo... 177 8e-48
sp|P25867|UBCD1_DROME Ubiquitin-conjugating enzyme E2-17 kDa OS=... 177 1e-47
sp|P62840|UB2D2_XENLA Ubiquitin-conjugating enzyme E2 D2 OS=Xeno... 176 3e-47
sp|P62839|UB2D2_RAT Ubiquitin-conjugating enzyme E2 D2 OS=Rattus... 176 3e-47
sp|P62838|UB2D2_MOUSE Ubiquitin-conjugating enzyme E2 D2 OS=Mus ... 176 3e-47
sp|P62837|UB2D2_HUMAN Ubiquitin-conjugating enzyme E2 D2 OS=Homo... 176 3e-47
sp|Q1RMX2|UB2D2_BOVIN Ubiquitin-conjugating enzyme E2 D2 OS=Bos ... 176 3e-47
sp|P61078|UB2D3_RAT Ubiquitin-conjugating enzyme E2 D3 OS=Rattus... 175 7e-47
sp|Q5R4V7|UB2D3_PONAB Ubiquitin-conjugating enzyme E2 D3 OS=Pong... 175 7e-47
sp|P61079|UB2D3_MOUSE Ubiquitin-conjugating enzyme E2 D3 OS=Mus ... 175 7e-47
sp|Q4R5N4|UB2D3_MACFA Ubiquitin-conjugating enzyme E2 D3 OS=Maca... 175 7e-47
sp|P61077|UB2D3_HUMAN Ubiquitin-conjugating enzyme E2 D3 OS=Homo... 175 7e-47
sp|Q06AA9|UB2D2_PIG Ubiquitin-conjugating enzyme E2 D2 OS=Sus sc... 175 7e-47
sp|P15732|UBC5_YEAST Ubiquitin-conjugating enzyme E2-16 kDa OS=S... 175 3e-46
sp|P61080|UB2D1_MOUSE Ubiquitin-conjugating enzyme E2 D1 OS=Mus ... 172 3e-46
sp|P51668|UB2D1_HUMAN Ubiquitin-conjugating enzyme E2 D1 OS=Homo... 172 3e-46
sp|Q2TA10|UB2D1_BOVIN Ubiquitin-conjugating enzyme E2 D1 OS=Bos ... 172 3e-46

>sp|P35134|UBC11_ARATH Ubiquitin-conjugating enzyme E2 11
OS=Arabidopsis thaliana GN=UBC11 PE=2 SV=2
Length = 148

Score = 192 bits (487), Expect(2) = 1e-50
Identities = 88/104 (84%), Positives = 94/104 (90%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VF V+IHFPPDYPFKPPKV+F TKVYHPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYAGGVFLVSIHFPPDYPFKPPKVSFKTKVYHPNINSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICSLLT PNPDDPLVPEIAH+Y+ R +YE TAR+WTQKYAM
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHMYKTDRSKYESTARSWTQKYAM 147



Score = 28.5 bits (62), Expect(2) = 1e-50
Identities = 10/13 (76%), Positives = 12/13 (92%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
V +D+FHWQATIM
Sbjct: 26 VAEDMFHWQATIM 38


>sp|Q9FKT3|UBC30_ARATH Ubiquitin carrier protein E2 30
OS=Arabidopsis thaliana GN=UBC30 PE=2 SV=1
Length = 148

Score = 191 bits (485), Expect(2) = 3e-50
Identities = 88/104 (84%), Positives = 93/104 (89%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VF VTIHFPPDYPFKPPKV F TKVYHPNINSNGSICLDILKEQWSPALT+SKVL
Sbjct: 44 PFAGGVFLVTIHFPPDYPFKPPKVAFRTKVYHPNINSNGSICLDILKEQWSPALTVSKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICSLLT PNPDDPLVPEIAHIY+ R +YE TA++WTQKYAM
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHIYKTDRVKYESTAQSWTQKYAM 147



Score = 27.7 bits (60), Expect(2) = 3e-50
Identities = 10/12 (83%), Positives = 11/12 (91%)
Frame = -1

Query: 545 GDDLFHWQATIM 510
GDD+F WQATIM
Sbjct: 27 GDDMFQWQATIM 38


>sp|Q94F47|UBC28_ARATH Ubiquitin carrier protein E2 28
OS=Arabidopsis thaliana GN=UBC28 PE=2 SV=1
Length = 148

Score = 189 bits (481), Expect(2) = 5e-50
Identities = 87/104 (83%), Positives = 93/104 (89%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VF VTIHFPPDYPFKPPKV F TKV+HPN+NSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNVNSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICSLLT PNPDDPLVPEIAH+Y+ R +YE TAR+WTQKYAM
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHMYKTDRAKYESTARSWTQKYAM 147



Score = 28.5 bits (62), Expect(2) = 5e-50
Identities = 10/13 (76%), Positives = 12/13 (92%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
V +D+FHWQATIM
Sbjct: 26 VAEDMFHWQATIM 38


>sp|P35133|UBC10_ARATH Ubiquitin-conjugating enzyme E2 10
OS=Arabidopsis thaliana GN=UBC10 PE=1 SV=1
Length = 148

Score = 189 bits (480), Expect(2) = 7e-50
Identities = 88/109 (80%), Positives = 94/109 (86%)
Frame = -3

Query: 510 GXER*PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALT 331
G P G VF VTIHFPPDYPFKPPKV F TKV+HPNINSNGSICLDILKEQWSPALT
Sbjct: 39 GPSESPYAGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALT 98

Query: 330 ISKVLLSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
ISKVLLSICSLLT PNPDDPLVPEIAH+Y+ + +YE TAR+WTQKYAM
Sbjct: 99 ISKVLLSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARSWTQKYAM 147



Score = 28.5 bits (62), Expect(2) = 7e-50
Identities = 10/13 (76%), Positives = 12/13 (92%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
V +D+FHWQATIM
Sbjct: 26 VAEDMFHWQATIM 38


>sp|P35131|UBC8_ARATH Ubiquitin-conjugating enzyme E2 8
OS=Arabidopsis thaliana GN=UBC8 PE=1 SV=1
Length = 148

Score = 188 bits (478), Expect(2) = 1e-49
Identities = 88/104 (84%), Positives = 92/104 (88%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VF VTIHFPPDYPFKPPKV F TKV+HPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICSLLT PNPDDPLVPEIAH+Y+ R +YE TAR WTQKYAM
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHMYKTDRAKYEATARNWTQKYAM 147



Score = 28.5 bits (62), Expect(2) = 1e-49
Identities = 10/13 (76%), Positives = 12/13 (92%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
V +D+FHWQATIM
Sbjct: 26 VAEDMFHWQATIM 38


>sp|P35135|UBC4_SOLLC Ubiquitin-conjugating enzyme E2-17 kDa
OS=Solanum lycopersicum PE=2 SV=1
Length = 148

Score = 188 bits (478), Expect(2) = 1e-49
Identities = 87/104 (83%), Positives = 93/104 (89%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VF V+IHFPPDYPFKPPKV F TKV+HPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYAGGVFLVSIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICSLLT PNPDDPLVPEIAH+Y+ R +YE TAR+WTQKYAM
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHMYKTDRAKYETTARSWTQKYAM 147



Score = 28.5 bits (62), Expect(2) = 1e-49
Identities = 10/13 (76%), Positives = 12/13 (92%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
V +D+FHWQATIM
Sbjct: 26 VAEDMFHWQATIM 38


>sp|P46595|UBC4_SCHPO Ubiquitin-conjugating enzyme E2 4
OS=Schizosaccharomyces pombe GN=ubc4 PE=2 SV=1
Length = 147

Score = 184 bits (466), Expect(2) = 1e-49
Identities = 82/104 (78%), Positives = 94/104 (90%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFF++IHFP DYPFKPPKVNF+T++YHPNINSNGSICLDIL++QWSPALTISKVL
Sbjct: 44 PYAGGVFFLSIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICSLLT PNPDDPLVPEIAH+Y+ R RYE +AR WT+KYA+
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHVYKTDRSRYELSAREWTRKYAI 147



Score = 33.1 bits (74), Expect(2) = 1e-49
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
VGDDLFHWQATIM
Sbjct: 26 VGDDLFHWQATIM 38


>sp|P35132|UBC9_ARATH SUMO-conjugating enzyme UBC9 OS=Arabidopsis
thaliana GN=UBC9 PE=1 SV=1
Length = 148

Score = 188 bits (477), Expect(2) = 2e-49
Identities = 87/104 (83%), Positives = 92/104 (88%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VF VTIHFPPDYPFKPPKV F TKV+HPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYSGGVFLVTIHFPPDYPFKPPKVAFRTKVFHPNINSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICSLLT PNPDDPLVPEIAH+Y+ + +YE TAR WTQKYAM
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHMYKTDKNKYESTARTWTQKYAM 147



Score = 28.5 bits (62), Expect(2) = 2e-49
Identities = 10/13 (76%), Positives = 12/13 (92%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
V +D+FHWQATIM
Sbjct: 26 VAEDMFHWQATIM 38


>sp|Q9UVR2|UBC1_MAGGR Ubiquitin-conjugating enzyme E2-16 kDa
OS=Magnaporthe grisea GN=UBC1 PE=3 SV=2
Length = 147

Score = 183 bits (465), Expect(2) = 4e-49
Identities = 81/104 (77%), Positives = 93/104 (89%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFF+ IHFP DYPFKPPKVNF+T++YHPNINSNGSICLDIL++QWSPALTISKVL
Sbjct: 44 PYAGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICS+LT PNPDDPLVPEIAH+Y+ R +YE TAR WT+KYA+
Sbjct: 104 LSICSMLTDPNPDDPLVPEIAHVYKTARAQYESTAREWTRKYAI 147



Score = 31.6 bits (70), Expect(2) = 4e-49
Identities = 12/13 (92%), Positives = 13/13 (100%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
VG+DLFHWQATIM
Sbjct: 26 VGEDLFHWQATIM 38


>sp|O74196|UBC1_COLGL Ubiquitin-conjugating enzyme E2-16 kDa
OS=Colletotrichum gloeosporioides GN=UBC1 PE=2 SV=1
Length = 147

Score = 183 bits (464), Expect(2) = 6e-49
Identities = 81/104 (77%), Positives = 93/104 (89%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFF+ IHFP DYPFKPPKVNF+T++YHPNINSNGSICLDIL++QWSPALTISKVL
Sbjct: 44 PYSGGVFFLAIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICS+LT PNPD+PLVPEIAH+Y+ R RYE TAR WT+KYA+
Sbjct: 104 LSICSMLTDPNPDEPLVPEIAHVYKTDRARYEATAREWTRKYAI 147



Score = 31.6 bits (70), Expect(2) = 6e-49
Identities = 12/13 (92%), Positives = 13/13 (100%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
VG+DLFHWQATIM
Sbjct: 26 VGEDLFHWQATIM 38


tr_hit_id A9NLA0
Definition tr|A9NLA0|A9NLA0_PICSI Ubiquitin carrier protein OS=Picea sitchensis
Align length 105
Score (bit) 205.0
E-value 1.0e-54
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912787|Adiantum capillus-veneris mRNA, clone:
YMU001_000022_H03.
(548 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9NLA0|A9NLA0_PICSI Ubiquitin carrier protein OS=Picea sitche... 205 1e-54
tr|Q8VWV2|Q8VWV2_PINPS Ubiquitin carrier protein (Fragment) OS=P... 205 1e-54
tr|Q9ZTZ8|Q9ZTZ8_PINRE Ubiquitin carrier protein OS=Pinus resino... 202 4e-54
tr|A9NV04|A9NV04_PICSI Ubiquitin carrier protein OS=Picea sitche... 202 4e-54
tr|B6U4K0|B6U4K0_MAIZE Ubiquitin-conjugating enzyme E2-17 kDa OS... 203 1e-53
tr|B3TLV3|B3TLV3_ELAGV Ubiquitin-conjugating enzyme OS=Elaeis gu... 202 1e-53
tr|Q69JN7|Q69JN7_ORYSJ Ubiquitin carrier protein OS=Oryza sativa... 202 3e-53
tr|B8BDZ9|B8BDZ9_ORYSI Putative uncharacterized protein OS=Oryza... 202 3e-53
tr|B4FCQ9|B4FCQ9_MAIZE Putative uncharacterized protein OS=Zea m... 200 2e-52
tr|Q4WWI8|Q4WWI8_ASPFU Ubiquitin carrier protein OS=Aspergillus ... 189 2e-50
tr|B0XZ36|B0XZ36_ASPFC Ubiquitin carrier protein OS=Aspergillus ... 189 2e-50
tr|A1D8A7|A1D8A7_NEOFI Ubiquitin carrier protein OS=Neosartorya ... 189 2e-50
tr|O48555|O48555_MAIZE Ubiquitin carrier protein OS=Zea mays GN=... 193 3e-50
tr|A5AI12|A5AI12_VITVI Ubiquitin carrier protein OS=Vitis vinife... 190 3e-50
tr|B6TDH5|B6TDH5_MAIZE Ubiquitin-conjugating enzyme E2-17 kDa OS... 192 4e-50
tr|Q8L458|Q8L458_ORYSJ Ubiquitin carrier protein OS=Oryza sativa... 192 4e-50
tr|B8ABB5|B8ABB5_ORYSI Putative uncharacterized protein OS=Oryza... 192 4e-50
tr|B4FC97|B4FC97_MAIZE Putative uncharacterized protein OS=Zea m... 192 4e-50
tr|A6N0N4|A6N0N4_ORYSI Ubiquitin carrier protein OS=Oryza sativa... 192 4e-50
tr|B2LUR9|B2LUR9_MALDO Ubiquitin conjugating enzyme 3 OS=Malus d... 191 5e-50
tr|A1CJ72|A1CJ72_ASPCL Ubiquitin carrier protein OS=Aspergillus ... 189 7e-50
tr|A6QV53|A6QV53_AJECN Ubiquitin carrier protein OS=Ajellomyces ... 188 7e-50
tr|Q7XR79|Q7XR79_ORYSJ Ubiquitin carrier protein OS=Oryza sativa... 190 9e-50
tr|Q259X8|Q259X8_ORYSA Ubiquitin carrier protein OS=Oryza sativa... 190 9e-50
tr|B6SZE0|B6SZE0_MAIZE Ubiquitin-conjugating enzyme E2-17 kDa OS... 190 9e-50
tr|A2XYQ9|A2XYQ9_ORYSI Ubiquitin carrier protein OS=Oryza sativa... 190 9e-50
tr|Q1EAB2|Q1EAB2_COCIM Ubiquitin carrier protein OS=Coccidioides... 187 9e-50
tr|B6HEM5|B6HEM5_PENCH Pc20g07930 protein OS=Penicillium chrysog... 187 9e-50
tr|Q5B9M0|Q5B9M0_EMENI Ubiquitin carrier protein OS=Emericella n... 189 2e-49
tr|Q5XUV4|Q5XUV4_WHEAT Ubiquitin carrier protein OS=Triticum aes... 189 2e-49

>tr|A9NLA0|A9NLA0_PICSI Ubiquitin carrier protein OS=Picea
sitchensis PE=2 SV=1
Length = 148

Score = 205 bits (522), Expect(2) = 1e-54
Identities = 96/105 (91%), Positives = 98/105 (93%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFFV IHFPPDYPFKPPKVNF TKVYHPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYAGGVFFVMIHFPPDYPFKPPKVNFQTKVYHPNINSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAMN 181
LSICSLLT PNPDDPLVPEIAHIY++QR RYEETARAWTQKYAMN
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHIYKSQRSRYEETARAWTQKYAMN 148



Score = 31.6 bits (70), Expect(2) = 1e-54
Identities = 12/13 (92%), Positives = 13/13 (100%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
VG+DLFHWQATIM
Sbjct: 26 VGEDLFHWQATIM 38


>tr|Q8VWV2|Q8VWV2_PINPS Ubiquitin carrier protein (Fragment)
OS=Pinus pinaster PE=2 SV=1
Length = 140

Score = 205 bits (522), Expect(2) = 1e-54
Identities = 96/105 (91%), Positives = 98/105 (93%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFFV IHFPPDYPFKPPKVNF TKVYHPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 36 PYAGGVFFVMIHFPPDYPFKPPKVNFQTKVYHPNINSNGSICLDILKEQWSPALTISKVL 95

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAMN 181
LSICSLLT PNPDDPLVPEIAHIY++QR RYEETARAWTQKYAMN
Sbjct: 96 LSICSLLTDPNPDDPLVPEIAHIYKSQRSRYEETARAWTQKYAMN 140



Score = 31.6 bits (70), Expect(2) = 1e-54
Identities = 12/13 (92%), Positives = 13/13 (100%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
VG+DLFHWQATIM
Sbjct: 18 VGEDLFHWQATIM 30


>tr|Q9ZTZ8|Q9ZTZ8_PINRE Ubiquitin carrier protein OS=Pinus resinosa
PE=2 SV=1
Length = 148

Score = 202 bits (514), Expect(2) = 4e-54
Identities = 92/105 (87%), Positives = 97/105 (92%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFF+ IHFPPDYPFKPPKV F TKVYHPN+NSNGSICLDILKEQWSPALT+SKVL
Sbjct: 44 PYAGGVFFIVIHFPPDYPFKPPKVTFKTKVYHPNVNSNGSICLDILKEQWSPALTVSKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAMN 181
LSICSLLT PNPDDPLVPEIAHIY++QR RYEETARAWTQKYAMN
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHIYKSQRARYEETARAWTQKYAMN 148



Score = 33.1 bits (74), Expect(2) = 4e-54
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
VGDDLFHWQATIM
Sbjct: 26 VGDDLFHWQATIM 38


>tr|A9NV04|A9NV04_PICSI Ubiquitin carrier protein OS=Picea
sitchensis PE=2 SV=1
Length = 148

Score = 202 bits (514), Expect(2) = 4e-54
Identities = 92/105 (87%), Positives = 97/105 (92%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFF+ IHFPPDYPFKPPKV F TKVYHPN+NSNGSICLDILKEQWSPALT+SKVL
Sbjct: 44 PYAGGVFFIVIHFPPDYPFKPPKVTFKTKVYHPNVNSNGSICLDILKEQWSPALTVSKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAMN 181
LSICSLLT PNPDDPLVPEIAHIY++QR RYEETARAWTQKYAMN
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHIYKSQRARYEETARAWTQKYAMN 148



Score = 33.1 bits (74), Expect(2) = 4e-54
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
VGDDLFHWQATIM
Sbjct: 26 VGDDLFHWQATIM 38


>tr|B6U4K0|B6U4K0_MAIZE Ubiquitin-conjugating enzyme E2-17 kDa
OS=Zea mays PE=2 SV=1
Length = 148

Score = 203 bits (517), Expect(2) = 1e-53
Identities = 95/104 (91%), Positives = 97/104 (93%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFFV IHFPPDYPFKPPKVNF TKVYHPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYAGGVFFVNIHFPPDYPFKPPKVNFQTKVYHPNINSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSI SLLT PNPDDPLVPEIAH+Y+NQRPRYEETARAWTQKYAM
Sbjct: 104 LSISSLLTDPNPDDPLVPEIAHMYKNQRPRYEETARAWTQKYAM 147



Score = 30.0 bits (66), Expect(2) = 1e-53
Identities = 11/12 (91%), Positives = 12/12 (100%)
Frame = -1

Query: 545 GDDLFHWQATIM 510
G+DLFHWQATIM
Sbjct: 27 GEDLFHWQATIM 38


>tr|B3TLV3|B3TLV3_ELAGV Ubiquitin-conjugating enzyme OS=Elaeis
guineensis var. tenera PE=2 SV=1
Length = 148

Score = 202 bits (513), Expect(2) = 1e-53
Identities = 94/104 (90%), Positives = 96/104 (92%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFF+ IHFPPDYPFKPPKVNF TKVYHPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYSGGVFFIKIHFPPDYPFKPPKVNFQTKVYHPNINSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICSLLT PNPDDPLVPEIAHIY+ QR RYEETARAWTQKYAM
Sbjct: 104 LSICSLLTDPNPDDPLVPEIAHIYKTQRSRYEETARAWTQKYAM 147



Score = 31.6 bits (70), Expect(2) = 1e-53
Identities = 12/13 (92%), Positives = 13/13 (100%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
VG+DLFHWQATIM
Sbjct: 26 VGEDLFHWQATIM 38


>tr|Q69JN7|Q69JN7_ORYSJ Ubiquitin carrier protein OS=Oryza sativa
subsp. japonica GN=B1043F11.37 PE=2 SV=1
Length = 148

Score = 202 bits (514), Expect(2) = 3e-53
Identities = 94/104 (90%), Positives = 97/104 (93%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFFV IHFPPDYPFKPPKVNF TKVYHPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYAGGVFFVNIHFPPDYPFKPPKVNFQTKVYHPNINSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSI SLLT PNPDDPLVPEIAH+Y++QRPRYEETARAWTQKYAM
Sbjct: 104 LSISSLLTDPNPDDPLVPEIAHVYKSQRPRYEETARAWTQKYAM 147



Score = 30.0 bits (66), Expect(2) = 3e-53
Identities = 11/12 (91%), Positives = 12/12 (100%)
Frame = -1

Query: 545 GDDLFHWQATIM 510
G+DLFHWQATIM
Sbjct: 27 GEDLFHWQATIM 38


>tr|B8BDZ9|B8BDZ9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_30757 PE=4 SV=1
Length = 148

Score = 202 bits (514), Expect(2) = 3e-53
Identities = 94/104 (90%), Positives = 97/104 (93%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFFV IHFPPDYPFKPPKVNF TKVYHPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYAGGVFFVNIHFPPDYPFKPPKVNFQTKVYHPNINSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSI SLLT PNPDDPLVPEIAH+Y++QRPRYEETARAWTQKYAM
Sbjct: 104 LSISSLLTDPNPDDPLVPEIAHVYKSQRPRYEETARAWTQKYAM 147



Score = 30.0 bits (66), Expect(2) = 3e-53
Identities = 11/12 (91%), Positives = 12/12 (100%)
Frame = -1

Query: 545 GDDLFHWQATIM 510
G+DLFHWQATIM
Sbjct: 27 GEDLFHWQATIM 38


>tr|B4FCQ9|B4FCQ9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 148

Score = 200 bits (508), Expect(2) = 2e-52
Identities = 93/104 (89%), Positives = 96/104 (92%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFF+ IHFPPDYPFKPPKVNF TKVYHPNINSNGSICLDILKEQWSPALTISKVL
Sbjct: 44 PYAGGVFFINIHFPPDYPFKPPKVNFQTKVYHPNINSNGSICLDILKEQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSI SLLT PNPDDPLVPEIAH+Y+NQR RYEETARAWTQKYAM
Sbjct: 104 LSISSLLTDPNPDDPLVPEIAHMYKNQRQRYEETARAWTQKYAM 147



Score = 30.0 bits (66), Expect(2) = 2e-52
Identities = 11/12 (91%), Positives = 12/12 (100%)
Frame = -1

Query: 545 GDDLFHWQATIM 510
G+DLFHWQATIM
Sbjct: 27 GEDLFHWQATIM 38


>tr|Q4WWI8|Q4WWI8_ASPFU Ubiquitin carrier protein OS=Aspergillus
fumigatus GN=AFUA_3G06030 PE=3 SV=1
Length = 147

Score = 189 bits (481), Expect(2) = 2e-50
Identities = 84/104 (80%), Positives = 95/104 (91%)
Frame = -3

Query: 495 PLLGWVFFVTIHFPPDYPFKPPKVNFSTKVYHPNINSNGSICLDILKEQWSPALTISKVL 316
P G VFF+TIHFP DYPFKPPKVNF+T++YHPNINSNGSICLDIL++QWSPALTISKVL
Sbjct: 44 PYSGGVFFLTIHFPTDYPFKPPKVNFTTRIYHPNINSNGSICLDILRDQWSPALTISKVL 103

Query: 315 LSICSLLTGPNPDDPLVPEIAHIYQNQRPRYEETARAWTQKYAM 184
LSICS+LT PNPDDPLVPEIAH+Y+ RPRYE TAR WT+KYA+
Sbjct: 104 LSICSMLTDPNPDDPLVPEIAHVYKTDRPRYEATAREWTRKYAI 147



Score = 33.1 bits (74), Expect(2) = 2e-50
Identities = 13/13 (100%), Positives = 13/13 (100%)
Frame = -1

Query: 548 VGDDLFHWQATIM 510
VGDDLFHWQATIM
Sbjct: 26 VGDDLFHWQATIM 38