BP912809
Clone id YMU001_000023_B03
Library
Length 337
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000023_B03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TCAGAGGGANNTGTACAGGACTGGAAAAGGAGGTTTGAAACACTGGGAATAGAGCACAAA
GCTTTTGCTGAGGAGTCAGACTCCAGATGCAGCCTCCTCCAGAACAAGTACAGTAATCTA
GAAGAGAATGCTGCTTCGCTCTCATATCAGCTGGAAATTGTAAGAAAAGAAGCATCAGAT
TGGAGAAGTAAGTACGATCATTTGCTGTCTACACGTAAGGCAGAGGAAGACCGTATAGTT
GGAGAGAATGCAGCATTAAAAAGCAGATGTAGCTCTGCTGAAGCAAGGTTGGCTGCTGCT
AGATAGCAGGCAGAAGCTGCTAAAGAAGAAGCTTCTG
■■Homology search results ■■ -
sp_hit_id Q02566
Definition sp|Q02566|MYH6_MOUSE Myosin-6 OS=Mus musculus
Align length 77
Score (bit) 36.6
E-value 0.04
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912809|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_B03.
(337 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q02566|MYH6_MOUSE Myosin-6 OS=Mus musculus GN=Myh6 PE=1 SV=2 37 0.040
sp|P13533|MYH6_HUMAN Myosin-6 OS=Homo sapiens GN=MYH6 PE=1 SV=4 37 0.040
sp|P02563|MYH6_RAT Myosin-6 OS=Rattus norvegicus GN=Myh6 PE=2 SV=2 36 0.052
sp|P13539|MYH6_MESAU Myosin-6 OS=Mesocricetus auratus GN=MYH6 PE... 36 0.052
sp|P12847|MYH3_RAT Myosin-3 OS=Rattus norvegicus GN=Myh3 PE=2 SV=1 36 0.052
sp|P13541|MYH3_MOUSE Myosin-3 OS=Mus musculus GN=Myh3 PE=2 SV=2 36 0.052
sp|P13542|MYH8_MOUSE Myosin-8 OS=Mus musculus GN=Myh8 PE=2 SV=2 35 0.089
sp|Q076A4|MYH8_CANFA Myosin-8 OS=Canis familiaris GN=MYH8 PE=3 SV=1 35 0.089
sp|P11055|MYH3_HUMAN Myosin-3 OS=Homo sapiens GN=MYH3 PE=1 SV=2 35 0.12
sp|Q8MJV1|MYH2_HORSE Myosin-2 OS=Equus caballus GN=MYH2 PE=2 SV=1 35 0.12
sp|Q076A7|MYH2_CANFA Myosin-2 OS=Canis familiaris GN=MYH2 PE=3 SV=1 35 0.12
sp|Q076A5|MYH4_CANFA Myosin-4 OS=Canis familiaris GN=MYH4 PE=3 SV=1 35 0.15
sp|Q9TV63|MYH2_PIG Myosin-2 OS=Sus scrofa GN=MYH2 PE=2 SV=1 35 0.15
sp|Q9UKX2|MYH2_HUMAN Myosin-2 OS=Homo sapiens GN=MYH2 PE=1 SV=1 35 0.15
sp|Q076A3|MYH13_CANFA Myosin-13 OS=Canis familiaris GN=MYH13 PE=... 35 0.15
sp|Q29RW1|MYH4_RAT Myosin-4 OS=Rattus norvegicus GN=Myh4 PE=2 SV=1 34 0.20
sp|Q5SX39|MYH4_MOUSE Myosin-4 OS=Mus musculus GN=Myh4 PE=2 SV=1 34 0.20
sp|Q62812|MYH9_RAT Myosin-9 OS=Rattus norvegicus GN=Myh9 PE=1 SV=3 34 0.26
sp|Q8VDD5|MYH9_MOUSE Myosin-9 OS=Mus musculus GN=Myh9 PE=1 SV=4 34 0.26
sp|P13535|MYH8_HUMAN Myosin-8 OS=Homo sapiens GN=MYH8 PE=1 SV=3 34 0.26
sp|Q9TV62|MYH4_PIG Myosin-4 OS=Sus scrofa GN=MYH4 PE=2 SV=1 34 0.26
sp|Q9BE41|MYH2_BOVIN Myosin-2 OS=Bos taurus GN=MYH2 PE=2 SV=1 34 0.26
sp|P14105|MYH9_CHICK Myosin-9 OS=Gallus gallus GN=MYH9 PE=2 SV=1 33 0.34
sp|Q076A6|MYH1_CANFA Myosin-1 OS=Canis familiaris GN=MYH1 PE=3 SV=2 33 0.34
sp|Q9BE40|MYH1_BOVIN Myosin-1 OS=Bos taurus GN=MYH1 PE=2 SV=2 33 0.34
sp|Q258K2|MYH9_CANFA Myosin-9 OS=Canis familiaris GN=MYH9 PE=2 SV=1 33 0.44
sp|P02564|MYH7_RAT Myosin-7 OS=Rattus norvegicus GN=Myh7 PE=2 SV=2 33 0.44
sp|P79293|MYH7_PIG Myosin-7 OS=Sus scrofa GN=MYH7 PE=2 SV=2 33 0.44
sp|Q91Z83|MYH7_MOUSE Myosin-7 OS=Mus musculus GN=Myh7 PE=1 SV=1 33 0.44
sp|P12883|MYH7_HUMAN Myosin-7 OS=Homo sapiens GN=MYH7 PE=1 SV=5 33 0.44

>sp|Q02566|MYH6_MOUSE Myosin-6 OS=Mus musculus GN=Myh6 PE=1 SV=2
Length = 1938

Score = 36.6 bits (83), Expect = 0.040
Identities = 25/77 (32%), Positives = 35/77 (45%), Gaps = 5/77 (6%)
Frame = +1

Query: 13 VQDWKRRFETLGIEHKAFA---EESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDW 183
++D KR+ E G A A + S C LL+ +Y E A L L E + W
Sbjct: 1314 MEDLKRQLEEEGKAKNALAHALQSSRHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQW 1373

Query: 184 RSKY--DHLLSTRKAEE 228
R+KY D + T + EE
Sbjct: 1374 RTKYETDAIQRTEELEE 1390


>sp|P13533|MYH6_HUMAN Myosin-6 OS=Homo sapiens GN=MYH6 PE=1 SV=4
Length = 1939

Score = 36.6 bits (83), Expect = 0.040
Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 5/77 (6%)
Frame = +1

Query: 13 VQDWKRRFETLGIEHKAFAEESDSR---CSLLQNKYSNLEENAASLSYQLEIVRKEASDW 183
++D KR+ E G A A S C LL+ +Y E A L L E + W
Sbjct: 1314 MEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEETEAKAELQRVLSKANSEVAQW 1373

Query: 184 RSKY--DHLLSTRKAEE 228
R+KY D + T + EE
Sbjct: 1374 RTKYETDAIQRTEELEE 1390


>sp|P02563|MYH6_RAT Myosin-6 OS=Rattus norvegicus GN=Myh6 PE=2 SV=2
Length = 1938

Score = 36.2 bits (82), Expect = 0.052
Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 5/77 (6%)
Frame = +1

Query: 13 VQDWKRRFETLGIEHKAFAEESDSR---CSLLQNKYSNLEENAASLSYQLEIVRKEASDW 183
++D KR+ E G A A S C LL+ +Y E A L L E + W
Sbjct: 1313 MEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQW 1372

Query: 184 RSKY--DHLLSTRKAEE 228
R+KY D + T + EE
Sbjct: 1373 RTKYETDAIQRTEELEE 1389


>sp|P13539|MYH6_MESAU Myosin-6 OS=Mesocricetus auratus GN=MYH6 PE=2
SV=2
Length = 1939

Score = 36.2 bits (82), Expect = 0.052
Identities = 25/77 (32%), Positives = 34/77 (44%), Gaps = 5/77 (6%)
Frame = +1

Query: 13 VQDWKRRFETLGIEHKAFAEESDSR---CSLLQNKYSNLEENAASLSYQLEIVRKEASDW 183
++D KR+ E G A A S C LL+ +Y E A L L E + W
Sbjct: 1314 MEDLKRQLEEEGKAKNALAHALQSARHDCDLLREQYEEEMEAKAELQRVLSKANSEVAQW 1373

Query: 184 RSKY--DHLLSTRKAEE 228
R+KY D + T + EE
Sbjct: 1374 RTKYETDAIQRTEELEE 1390


>sp|P12847|MYH3_RAT Myosin-3 OS=Rattus norvegicus GN=Myh3 PE=2 SV=1
Length = 1940

Score = 36.2 bits (82), Expect = 0.052
Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%)
Frame = +1

Query: 13 VQDWKRRFETLGIEHKAFA---EESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDW 183
+++ KR+ E A A + S C LL+ +Y +E A L L E + W
Sbjct: 1313 IEELKRQLEEENKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQW 1372

Query: 184 RSKY--DHLLSTRKAEE 228
R+KY D + T + EE
Sbjct: 1373 RTKYETDAIQRTEELEE 1389


>sp|P13541|MYH3_MOUSE Myosin-3 OS=Mus musculus GN=Myh3 PE=2 SV=2
Length = 1940

Score = 36.2 bits (82), Expect = 0.052
Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%)
Frame = +1

Query: 13 VQDWKRRFETLGIEHKAFA---EESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDW 183
+++ KR+ E A A + S C LL+ +Y +E A L L E + W
Sbjct: 1313 IEELKRQLEEENKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQW 1372

Query: 184 RSKY--DHLLSTRKAEE 228
R+KY D + T + EE
Sbjct: 1373 RTKYETDAIQRTEELEE 1389


>sp|P13542|MYH8_MOUSE Myosin-8 OS=Mus musculus GN=Myh8 PE=2 SV=2
Length = 1937

Score = 35.4 bits (80), Expect = 0.089
Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%)
Frame = +1

Query: 13 VQDWKRRFETLGIEHKAFA---EESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDW 183
+++ KR+ E A A + S C LL+ +Y +E A L L E + W
Sbjct: 1315 IEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQW 1374

Query: 184 RSKY--DHLLSTRKAEE 228
R+KY D + T + EE
Sbjct: 1375 RTKYETDAIQRTEELEE 1391


>sp|Q076A4|MYH8_CANFA Myosin-8 OS=Canis familiaris GN=MYH8 PE=3 SV=1
Length = 1939

Score = 35.4 bits (80), Expect = 0.089
Identities = 23/77 (29%), Positives = 35/77 (45%), Gaps = 5/77 (6%)
Frame = +1

Query: 13 VQDWKRRFETLGIEHKAFA---EESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDW 183
+++ KR+ E A A + S C LL+ +Y +E A L L E + W
Sbjct: 1317 IEELKRQLEEETKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQW 1376

Query: 184 RSKY--DHLLSTRKAEE 228
R+KY D + T + EE
Sbjct: 1377 RTKYETDAIQRTEELEE 1393


>sp|P11055|MYH3_HUMAN Myosin-3 OS=Homo sapiens GN=MYH3 PE=1 SV=2
Length = 1940

Score = 35.0 bits (79), Expect = 0.12
Identities = 23/76 (30%), Positives = 34/76 (44%), Gaps = 5/76 (6%)
Frame = +1

Query: 16 QDWKRRFETLGIEHKAFA---EESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWR 186
++ KR+ E A A + S C LL+ +Y +E A L L E + WR
Sbjct: 1314 EELKRQLEEENKAKNALAHALQSSRHDCDLLREQYEEEQEGKAELQRALSKANSEVAQWR 1373

Query: 187 SKY--DHLLSTRKAEE 228
+KY D + T + EE
Sbjct: 1374 TKYETDAIQRTEELEE 1389


>sp|Q8MJV1|MYH2_HORSE Myosin-2 OS=Equus caballus GN=MYH2 PE=2 SV=1
Length = 1937

Score = 35.0 bits (79), Expect = 0.12
Identities = 23/77 (29%), Positives = 36/77 (46%), Gaps = 5/77 (6%)
Frame = +1

Query: 13 VQDWKRRFETLGIEHKAFA---EESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDW 183
+++ KR+ E A A + S C LL+ +Y +E+ A L L E + W
Sbjct: 1314 IEELKRQLEEEIKAKNALAHALQSSRHDCDLLREQYEEEQESKAELQRALSKANSEVAQW 1373

Query: 184 RSKY--DHLLSTRKAEE 228
R+KY D + T + EE
Sbjct: 1374 RTKYETDAIQRTEELEE 1390


tr_hit_id A9TME2
Definition tr|A9TME2|A9TME2_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 82
Score (bit) 70.9
E-value 3.0e-11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912809|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_B03.
(337 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TME2|A9TME2_PHYPA Predicted protein OS=Physcomitrella paten... 71 3e-11
tr|A9TZU7|A9TZU7_PHYPA Predicted protein OS=Physcomitrella paten... 68 3e-10
tr|A9SZ08|A9SZ08_PHYPA Predicted protein OS=Physcomitrella paten... 67 4e-10
tr|A9SG17|A9SG17_PHYPA Predicted protein OS=Physcomitrella paten... 64 5e-09
tr|A7QPR3|A7QPR3_VITVI Chromosome chr10 scaffold_138, whole geno... 62 2e-08
tr|A3B6T9|A3B6T9_ORYSJ Putative uncharacterized protein OS=Oryza... 61 3e-08
tr|Q6K2Y3|Q6K2Y3_ORYSJ Os02g0307000 protein OS=Oryza sativa subs... 60 7e-08
tr|B8AGB0|B8AGB0_ORYSI Putative uncharacterized protein OS=Oryza... 60 7e-08
tr|A3A5Z0|A3A5Z0_ORYSJ Putative uncharacterized protein OS=Oryza... 60 7e-08
tr|A5C116|A5C116_VITVI Putative uncharacterized protein OS=Vitis... 54 4e-06
tr|Q9FNL5|Q9FNL5_ARATH Similarity to guanylate binding protein O... 40 0.045
tr|B5DWF4|B5DWF4_DROPS GA26457 OS=Drosophila pseudoobscura pseud... 37 0.38
tr|B4G468|B4G468_DROPE GL23026 OS=Drosophila persimilis GN=GL230... 37 0.50
tr|Q2TAW4|Q2TAW4_MOUSE Myosin, heavy polypeptide 6, cardiac musc... 37 0.65
tr|B2RQQ1|B2RQQ1_MOUSE Myosin, heavy polypeptide 6, cardiac musc... 37 0.65
tr|Q076A8|Q076A8_CANFA Developmental myosin heavy chain embryoni... 36 0.84
tr|A7P315|A7P315_VITVI Chromosome chr1 scaffold_5, whole genome ... 36 1.1
tr|A5BQE9|A5BQE9_VITVI Putative uncharacterized protein OS=Vitis... 36 1.1
tr|B4PUU5|B4PUU5_DROYA GE24157 OS=Drosophila yakuba GN=GE24157 P... 36 1.1
tr|A5K7Q3|A5K7Q3_PLAVI Putative uncharacterized protein OS=Plasm... 36 1.1
tr|B2RWW8|B2RWW8_MOUSE Myosin, heavy polypeptide 8, skeletal mus... 35 1.4
tr|A0C5W1|A0C5W1_PARTE Chromosome undetermined scaffold_150, who... 35 1.4
tr|A0BRU4|A0BRU4_PARTE Chromosome undetermined scaffold_123, who... 35 1.4
tr|A4RAC9|A4RAC9_MAGGR Putative uncharacterized protein OS=Magna... 35 1.4
tr|A7Q3Z2|A7Q3Z2_VITVI Chromosome chr13 scaffold_48, whole genom... 35 1.9
tr|A6QPA6|A6QPA6_BOVIN MYH3 protein OS=Bos taurus GN=MYH3 PE=2 SV=1 35 1.9
tr|Q9VNE4|Q9VNE4_DROME Asterless OS=Drosophila melanogaster GN=a... 35 1.9
tr|A0DHX6|A0DHX6_PARTE Chromosome undetermined scaffold_51, whol... 35 1.9
tr|Q5GJ67|Q5GJ67_HUMAN Hypothetical rhabdomyosarcoma antigen MU-... 35 1.9
tr|Q59PD2|Q59PD2_CANAL Putative uncharacterized protein SPA2 OS=... 35 1.9

>tr|A9TME2|A9TME2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_147714 PE=4 SV=1
Length = 617

Score = 70.9 bits (172), Expect = 3e-11
Identities = 34/82 (41%), Positives = 56/82 (68%)
Frame = +1

Query: 16 QDWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKY 195
QDWK+R+E + ++ +E + ++ + +Q K ++LEE A+L QLE +KEA DW+SKY
Sbjct: 522 QDWKKRYENIMNDYNRASENAAAQYANVQKKVTSLEEKRATLLTQLESAKKEAFDWQSKY 581

Query: 196 DHLLSTRKAEEDRIVGENAALK 261
+ LS ++AE DR+ E A+L+
Sbjct: 582 EQNLSVQRAETDRLNSEVASLQ 603


>tr|A9TZU7|A9TZU7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_153240 PE=4 SV=1
Length = 1042

Score = 67.8 bits (164), Expect = 3e-10
Identities = 28/78 (35%), Positives = 54/78 (69%)
Frame = +1

Query: 16 QDWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKY 195
QDWK+R+E+ + K +E + ++ +++Q + + LEE +++ Q++ ++KEAS+WRSKY
Sbjct: 508 QDWKKRYESSVNDAKKSSESAATQHAIMQKRITTLEERHTTITSQMDEIKKEASEWRSKY 567

Query: 196 DHLLSTRKAEEDRIVGEN 249
+ LL+ + E++R EN
Sbjct: 568 EQLLNEHRMEQERSAAEN 585



Score = 48.5 bits (114), Expect = 2e-04
Identities = 27/82 (32%), Positives = 48/82 (58%), Gaps = 1/82 (1%)
Frame = +1

Query: 19 DWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKYD 198
+W+ ++E L EH+ E S + L+ N+ + E A++ QLE ++EA++WR KY+
Sbjct: 562 EWRSKYEQLLNEHRMEQERSAAENKLVLNRCTISETRLAAMREQLEASKEEATEWRHKYE 621

Query: 199 HLLSTRKAEEDRI-VGENAALK 261
+ + KA +R V ++ ALK
Sbjct: 622 TVEADTKAAIERANVSKDRALK 643


>tr|A9SZ08|A9SZ08_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_137671 PE=4 SV=1
Length = 639

Score = 67.0 bits (162), Expect = 4e-10
Identities = 31/82 (37%), Positives = 55/82 (67%)
Frame = +1

Query: 16 QDWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKY 195
QDWK+R+E + ++ +E + ++ + +Q K S+LEE ++L QLE +KEA DW SKY
Sbjct: 551 QDWKKRYENIMNDYNRASENAAAQYANVQKKVSSLEERRSNLLTQLEGAKKEALDWHSKY 610

Query: 196 DHLLSTRKAEEDRIVGENAALK 261
+ ++ ++AE +R+ E A+L+
Sbjct: 611 EQFVAAQRAETERLNSEIASLQ 632


>tr|A9SG17|A9SG17_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_184573 PE=4 SV=1
Length = 1042

Score = 63.5 bits (153), Expect = 5e-09
Identities = 28/82 (34%), Positives = 54/82 (65%)
Frame = +1

Query: 16 QDWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKY 195
Q+WK+R+E ++K +E + ++ ++LQ K LEE +++ +LE +K+A++W+SKY
Sbjct: 509 QEWKKRYELSINDYKKASESTATQHAILQKKVITLEERHNTVTSKLEAAKKQAAEWQSKY 568

Query: 196 DHLLSTRKAEEDRIVGENAALK 261
HLL+ R+ +++ I E L+
Sbjct: 569 QHLLNERRIDDEGIAAEMKVLQ 590



Score = 39.7 bits (91), Expect = 0.076
Identities = 19/72 (26%), Positives = 39/72 (54%)
Frame = +1

Query: 19 DWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKYD 198
+W+ +++ L E + E + +LQN+ + E A++ Q + ++EA +WR K+D
Sbjct: 563 EWQSKYQHLLNERRIDDEGIAAEMKVLQNRCTTAEARLAAMREQCDAAKEEAVEWRHKHD 622

Query: 199 HLLSTRKAEEDR 234
+ + KA +R
Sbjct: 623 TIEADTKAAIER 634


>tr|A7QPR3|A7QPR3_VITVI Chromosome chr10 scaffold_138, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00003041001
PE=4 SV=1
Length = 1058

Score = 61.6 bits (148), Expect = 2e-08
Identities = 34/87 (39%), Positives = 53/87 (60%)
Frame = +1

Query: 1 SEGXVQDWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASD 180
SE ++ +R+E + K A++ SR + LQ+K S+LEE +SLS L+ R+E+ +
Sbjct: 525 SEKYKSEYLKRYEDAINDKKKLADDYMSRITNLQSKGSSLEERCSSLSKTLDSARQESLE 584

Query: 181 WRSKYDHLLSTRKAEEDRIVGENAALK 261
W+ KY+ +L +KAEED E A LK
Sbjct: 585 WKRKYEQVLGKQKAEEDTANAEIAILK 611



Score = 40.4 bits (93), Expect = 0.045
Identities = 18/69 (26%), Positives = 43/69 (62%)
Frame = +1

Query: 19 DWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKYD 198
+WKR++E + + KA + +++ ++L+++ S + A+ Q + ++EA +W+ KYD
Sbjct: 584 EWKRKYEQVLGKQKAEEDTANAEIAILKSRSSAADARLAAAREQAQSAQEEAEEWKRKYD 643

Query: 199 HLLSTRKAE 225
++ R+A+
Sbjct: 644 --IAVREAK 650


>tr|A3B6T9|A3B6T9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_018761 PE=4 SV=1
Length = 1062

Score = 60.8 bits (146), Expect = 3e-08
Identities = 31/87 (35%), Positives = 52/87 (59%)
Frame = +1

Query: 1 SEGXVQDWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASD 180
SEG ++ RR+E + + + + R + LQ K S LEE SLS L+ ++E+ D
Sbjct: 530 SEGHRAEYLRRYEESINDKQKISRDYSGRIAELQTKSSKLEERCVSLSSALDNAKRESVD 589

Query: 181 WRSKYDHLLSTRKAEEDRIVGENAALK 261
W++KYDH L +KA+E ++ + A+L+
Sbjct: 590 WKNKYDHNLLQQKADESKLKSQIASLE 616



Score = 39.7 bits (91), Expect = 0.076
Identities = 19/72 (26%), Positives = 40/72 (55%)
Frame = +1

Query: 19 DWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKYD 198
DWK +++ ++ KA + S+ + L+++ + E +++ Q E ++EAS+W+ KY+
Sbjct: 589 DWKNKYDHNLLQQKADESKLKSQIASLESRVNISEGRLSAVREQAESAQEEASEWKRKYE 648

Query: 199 HLLSTRKAEEDR 234
+S K R
Sbjct: 649 VAVSEAKTALQR 660


>tr|Q6K2Y3|Q6K2Y3_ORYSJ Os02g0307000 protein OS=Oryza sativa subsp.
japonica GN=P0543C11.35 PE=4 SV=1
Length = 1082

Score = 59.7 bits (143), Expect = 7e-08
Identities = 28/87 (32%), Positives = 52/87 (59%)
Frame = +1

Query: 1 SEGXVQDWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASD 180
+E ++ +R+E E + +E+ + + L+ K S L+E SLS +L++VR E +D
Sbjct: 549 NEAHKSEYLKRYEAAISEKQRVSEDHSAHLANLRTKCSTLDERCLSLSKELDLVRHECTD 608

Query: 181 WRSKYDHLLSTRKAEEDRIVGENAALK 261
WR KY+ ++ +KAE+D + + A L+
Sbjct: 609 WRVKYEQYVTQQKAEQDGFISQLATLE 635



Score = 42.4 bits (98), Expect = 0.012
Identities = 20/73 (27%), Positives = 39/73 (53%)
Frame = +1

Query: 19 DWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKYD 198
DW+ ++E + KA + S+ + L+++YS+ E + Q + EA++WR KY+
Sbjct: 608 DWRVKYEQYVTQQKAEQDGFISQLATLESRYSSAEGKLGAAREQAAAAQDEATEWRDKYE 667

Query: 199 HLLSTRKAEEDRI 237
+ KA +R+
Sbjct: 668 TAAAQAKAALERL 680


>tr|B8AGB0|B8AGB0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_06894 PE=4 SV=1
Length = 1096

Score = 59.7 bits (143), Expect = 7e-08
Identities = 28/87 (32%), Positives = 52/87 (59%)
Frame = +1

Query: 1 SEGXVQDWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASD 180
+E ++ +R+E E + +E+ + + L+ K S L+E SLS +L++VR E +D
Sbjct: 563 NEAHKSEYLKRYEAAISEKQRVSEDHSAHLANLRTKCSTLDERCLSLSKELDLVRHECTD 622

Query: 181 WRSKYDHLLSTRKAEEDRIVGENAALK 261
WR KY+ ++ +KAE+D + + A L+
Sbjct: 623 WRVKYEQYVTQQKAEQDGFISQLATLE 649



Score = 42.4 bits (98), Expect = 0.012
Identities = 20/73 (27%), Positives = 39/73 (53%)
Frame = +1

Query: 19 DWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKYD 198
DW+ ++E + KA + S+ + L+++YS+ E + Q + EA++WR KY+
Sbjct: 622 DWRVKYEQYVTQQKAEQDGFISQLATLESRYSSAEGKLGAAREQAAAAQDEATEWRDKYE 681

Query: 199 HLLSTRKAEEDRI 237
+ KA +R+
Sbjct: 682 TAAAQAKAALERL 694


>tr|A3A5Z0|A3A5Z0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_006212 PE=4 SV=1
Length = 1107

Score = 59.7 bits (143), Expect = 7e-08
Identities = 28/87 (32%), Positives = 52/87 (59%)
Frame = +1

Query: 1 SEGXVQDWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASD 180
+E ++ +R+E E + +E+ + + L+ K S L+E SLS +L++VR E +D
Sbjct: 574 NEAHKSEYLKRYEAAISEKQRVSEDHSAHLANLRTKCSTLDERCLSLSKELDLVRHECTD 633

Query: 181 WRSKYDHLLSTRKAEEDRIVGENAALK 261
WR KY+ ++ +KAE+D + + A L+
Sbjct: 634 WRVKYEQYVTQQKAEQDGFISQLATLE 660



Score = 42.4 bits (98), Expect = 0.012
Identities = 20/73 (27%), Positives = 39/73 (53%)
Frame = +1

Query: 19 DWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKYD 198
DW+ ++E + KA + S+ + L+++YS+ E + Q + EA++WR KY+
Sbjct: 633 DWRVKYEQYVTQQKAEQDGFISQLATLESRYSSAEGKLGAAREQAAAAQDEATEWRDKYE 692

Query: 199 HLLSTRKAEEDRI 237
+ KA +R+
Sbjct: 693 TAAAQAKAALERL 705


>tr|A5C116|A5C116_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_029762 PE=4 SV=1
Length = 563

Score = 53.9 bits (128), Expect = 4e-06
Identities = 28/60 (46%), Positives = 40/60 (66%)
Frame = +1

Query: 82 SRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKYDHLLSTRKAEEDRIVGENAALK 261
SR + LQ+K S+LEE +SLS L+ R+E+ +W+ KY+ +L +KAEED E A LK
Sbjct: 12 SRITNLQSKGSSLEERCSSLSKTLDSARQESLEWKRKYEQVLGKQKAEEDTANAEIAILK 71



Score = 40.4 bits (93), Expect = 0.045
Identities = 18/69 (26%), Positives = 43/69 (62%)
Frame = +1

Query: 19 DWKRRFETLGIEHKAFAEESDSRCSLLQNKYSNLEENAASLSYQLEIVRKEASDWRSKYD 198
+WKR++E + + KA + +++ ++L+++ S + A+ Q + ++EA +W+ KYD
Sbjct: 44 EWKRKYEQVLGKQKAEEDTANAEIAILKSRSSAADARLAAAREQAQSAQEEAEEWKRKYD 103

Query: 199 HLLSTRKAE 225
++ R+A+
Sbjct: 104 --IAVREAK 110