BP912843
Clone id YMU001_000023_E05
Library
Length 463
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000023_E05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GTCCATGGACGAGTTTATCTTCGAGGGGCACACCTCTTCCTGCAACTATTTCTGTGAAGG
GCATCAATTTCACTGTGTTTGCAAGCAAGAAGTACGGTGATTATCACAGACTACTTAGTC
CAGGAAGAGATTATGAAGTAACTGCGAGCATGCATGGATATATTAGTCAAACAGCTGTAG
TGCTTGTTGAAGAAGGCAAGGCGGCACTCCTTGATTTCAAACTTCAACCCATGGCCCTTG
ATCATGGAGAAGGGGCATCTCTTGGACAAAATGCAACGGGCTCTCAAAAGATTTTGTATA
ATGAGAGCTCACGTGCCGGCGGGCTTGAACTCAACTCAGAGAGCTTCATATCCATGAAAG
ACGCGCTGGTGGAGCAGTTGGTTTCATGGAGAGAACAACAGAAGGCTGTTTATGATAGGG
ATGTTATCAGTGAAATAGTAGCTGCTCATCTGAAGACAACAAG
■■Homology search results ■■ -
sp_hit_id Q9JHW1
Definition sp|Q9JHW1|CBPD_RAT Carboxypeptidase D OS=Rattus norvegicus
Align length 67
Score (bit) 53.9
E-value 3.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912843|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_E05.
(463 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9JHW1|CBPD_RAT Carboxypeptidase D OS=Rattus norvegicus GN=Cp... 54 3e-07
sp|O89001|CBPD_MOUSE Carboxypeptidase D OS=Mus musculus GN=Cpd P... 53 6e-07
sp|A5A6K7|CBPE_PANTR Carboxypeptidase E OS=Pan troglodytes GN=CP... 52 1e-06
sp|P16870|CBPE_HUMAN Carboxypeptidase E OS=Homo sapiens GN=CPE P... 52 2e-06
sp|O75976|CBPD_HUMAN Carboxypeptidase D OS=Homo sapiens GN=CPD P... 50 4e-06
sp|Q90240|CBPD_ANAPL Carboxypeptidase D OS=Anas platyrhynchos GN... 50 4e-06
sp|Q00493|CBPE_MOUSE Carboxypeptidase E OS=Mus musculus GN=Cpe P... 50 5e-06
sp|Q4R4M3|CBPE_MACFA Carboxypeptidase E OS=Macaca fascicularis G... 50 5e-06
sp|P15087|CBPE_RAT Carboxypeptidase E OS=Rattus norvegicus GN=Cp... 49 1e-05
sp|Q9EQV8|CBPN_RAT Carboxypeptidase N catalytic chain OS=Rattus ... 48 2e-05
sp|P04836|CBPE_BOVIN Carboxypeptidase E OS=Bos taurus GN=CPE PE=... 48 2e-05
sp|Q9JJN5|CBPN_MOUSE Carboxypeptidase N catalytic chain OS=Mus m... 46 7e-05
sp|P37892|CBPE_LOPAM Carboxypeptidase E OS=Lophius americanus GN... 45 2e-04
sp|P15169|CBPN_HUMAN Carboxypeptidase N catalytic chain OS=Homo ... 44 4e-04
sp|Q2KJ83|CBPN_BOVIN Carboxypeptidase N catalytic chain OS=Bos t... 43 6e-04
sp|Q9Z100|CPXM1_MOUSE Probable carboxypeptidase X1 OS=Mus muscul... 41 0.003
sp|A2RUV9|AEBP1_RAT Adipocyte enhancer-binding protein 1 OS=Ratt... 41 0.003
sp|Q640N1|AEBP1_MOUSE Adipocyte enhancer-binding protein 1 OS=Mu... 41 0.003
sp|Q96SM3|CPXM1_HUMAN Probable carboxypeptidase X1 OS=Homo sapie... 40 0.006
sp|Q9D2L5|CPXM2_MOUSE Carboxypeptidase-like protein X2 OS=Mus mu... 39 0.011
sp|P83852|CBPD_LOPSP Carboxypeptidase D (Fragment) OS=Lophonetta... 39 0.011
sp|Q8N436|CPXM2_HUMAN Carboxypeptidase-like protein X2 OS=Homo s... 39 0.014
sp|Q8QGP3|CBPZ_CHICK Carboxypeptidase Z OS=Gallus gallus GN=CPZ ... 38 0.018
sp|Q8IUX7|AEBP1_HUMAN Adipocyte enhancer-binding protein 1 OS=Ho... 38 0.018
sp|P42787|CBPD_DROME Carboxypeptidase D OS=Drosophila melanogast... 38 0.024
sp|Q66K79|CBPZ_HUMAN Carboxypeptidase Z OS=Homo sapiens GN=CPZ P... 35 0.12
sp|Q8R4V4|CBPZ_MOUSE Carboxypeptidase Z OS=Mus musculus GN=Cpz P... 34 0.27
sp|O54858|CBPZ_RAT Carboxypeptidase Z OS=Rattus norvegicus GN=Cp... 33 0.45
sp|Q92050|WNT5B_DANRE Protein Wnt-5b OS=Danio rerio GN=wnt5b PE=... 33 0.77
sp|O83893|Y923_TREPA Uncharacterized protein TP_0923 OS=Treponem... 32 1.0

>sp|Q9JHW1|CBPD_RAT Carboxypeptidase D OS=Rattus norvegicus GN=Cpd
PE=2 SV=2
Length = 1378

Score = 53.9 bits (128), Expect = 3e-07
Identities = 31/67 (46%), Positives = 43/67 (64%), Gaps = 1/67 (1%)
Frame = +3

Query: 42 ATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTA-VVLVEEGKAALLDF 218
ATISV GIN + + ++GD+HRLL PG Y +TA GY+ T ++V+EG A +DF
Sbjct: 400 ATISVAGINHNI-TTGRFGDFHRLLIPG-SYNLTAVSPGYMPLTINNIVVKEGPATEIDF 457

Query: 219 KLQPMAL 239
LQP +
Sbjct: 458 SLQPTVM 464



Score = 42.4 bits (98), Expect = 0.001
Identities = 32/83 (38%), Positives = 42/83 (50%)
Frame = +3

Query: 36 LPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKAALLD 215
L AT+SV IN V + K GDY RLL PG Y++TAS GY T V V A ++
Sbjct: 810 LNATLSVAEINHPV-TTYKAGDYWRLLVPGT-YKITASARGYNPVTKNVTVRSEGAIQVN 867

Query: 216 FKLQPMALDHGEGASLGQNATGS 284
F L + D + G+ + S
Sbjct: 868 FTLVRSSTDANNESKKGKGHSTS 890


>sp|O89001|CBPD_MOUSE Carboxypeptidase D OS=Mus musculus GN=Cpd PE=1
SV=1
Length = 1377

Score = 53.1 bits (126), Expect = 6e-07
Identities = 32/82 (39%), Positives = 48/82 (58%), Gaps = 1/82 (1%)
Frame = +3

Query: 42 ATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTA-VVLVEEGKAALLDF 218
ATISV GIN + + ++GD+HRLL PG Y +TA GY+ T ++V+EG A +DF
Sbjct: 399 ATISVAGINHNI-TTGRFGDFHRLLVPG-TYNLTALSTGYMPLTINNIMVKEGPATEMDF 456

Query: 219 KLQPMALDHGEGASLGQNATGS 284
L+P + G++ G+
Sbjct: 457 SLRPTVMSVMPGSTEAVTTPGT 478



Score = 42.7 bits (99), Expect = 7e-04
Identities = 32/83 (38%), Positives = 42/83 (50%)
Frame = +3

Query: 36 LPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKAALLD 215
L AT+SV IN V + K GDY RLL PG Y++TAS GY T V V A ++
Sbjct: 809 LNATLSVAEINHPV-TTYKAGDYWRLLVPGT-YKITASARGYNPVTKNVTVRSEGAVQVN 866

Query: 216 FKLQPMALDHGEGASLGQNATGS 284
F L + D + G+ + S
Sbjct: 867 FTLVRSSADANNESKKGRGHSTS 889


>sp|A5A6K7|CBPE_PANTR Carboxypeptidase E OS=Pan troglodytes GN=CPE
PE=2 SV=1
Length = 476

Score = 52.0 bits (123), Expect = 1e-06
Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
Frame = +3

Query: 24 RGTPLP-ATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGK 200
+G P+ ATISV+GI+ V S K GDY RLL PG +Y++TAS GY++ T V V
Sbjct: 384 QGNPIANATISVEGIDHDV-TSAKDGDYWRLLIPG-NYKLTASAPGYLAVTKKVAVPYSP 441

Query: 201 AALLDFKLQ 227
AA +DF+L+
Sbjct: 442 AAGVDFELE 450


>sp|P16870|CBPE_HUMAN Carboxypeptidase E OS=Homo sapiens GN=CPE PE=2
SV=1
Length = 476

Score = 51.6 bits (122), Expect = 2e-06
Identities = 34/69 (49%), Positives = 46/69 (66%), Gaps = 1/69 (1%)
Frame = +3

Query: 24 RGTPLP-ATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGK 200
+G P+ ATISV+GI+ V S K GDY RLL PG +Y++TAS GY++ T V V
Sbjct: 384 QGNPIANATISVEGIDHDV-TSAKDGDYWRLLIPG-NYKLTASAPGYLAITKKVAVPYSP 441

Query: 201 AALLDFKLQ 227
AA +DF+L+
Sbjct: 442 AAGVDFELE 450


>sp|O75976|CBPD_HUMAN Carboxypeptidase D OS=Homo sapiens GN=CPD PE=1
SV=2
Length = 1380

Score = 50.4 bits (119), Expect = 4e-06
Identities = 29/64 (45%), Positives = 42/64 (65%), Gaps = 1/64 (1%)
Frame = +3

Query: 42 ATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAV-VLVEEGKAALLDF 218
ATISV GIN + + ++GD++RLL PG Y +T + GY+ T V+V+EG A +DF
Sbjct: 400 ATISVAGINHNI-TTGRFGDFYRLLVPG-TYNLTVVLTGYMPLTVTNVVVKEGPATEVDF 457

Query: 219 KLQP 230
L+P
Sbjct: 458 SLRP 461



Score = 47.0 bits (110), Expect = 4e-05
Identities = 34/83 (40%), Positives = 44/83 (53%)
Frame = +3

Query: 36 LPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKAALLD 215
L ATISV IN V + K GDY RLL PG Y++TAS GY T V V+ A ++
Sbjct: 810 LNATISVAEINHPV-TTYKTGDYWRLLVPGT-YKITASARGYNPVTKNVTVKSEGAIQVN 867

Query: 216 FKLQPMALDHGEGASLGQNATGS 284
F L + D + G+ A+ S
Sbjct: 868 FTLVRSSTDSNNESKKGKGASSS 890


>sp|Q90240|CBPD_ANAPL Carboxypeptidase D OS=Anas platyrhynchos
GN=CPD PE=1 SV=1
Length = 1389

Score = 50.4 bits (119), Expect = 4e-06
Identities = 32/64 (50%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
Frame = +3

Query: 42 ATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAV-VLVEEGKAALLDF 218
ATI V GI + A K +GDYHRLL PG Y VTA + GY T + V+E A ++DF
Sbjct: 403 ATIVVAGIAHNITAGK-FGDYHRLLVPG-TYNVTAVVMGYAPVTKENIEVKEADATVVDF 460

Query: 219 KLQP 230
LQP
Sbjct: 461 SLQP 464



Score = 38.9 bits (89), Expect = 0.011
Identities = 29/63 (46%), Positives = 34/63 (53%)
Frame = +3

Query: 36 LPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKAALLD 215
L ATISV IN V + K GDY RLL G Y+VTAS GY T V V+ ++
Sbjct: 819 LNATISVADINHPV-TTYKDGDYWRLLVQGT-YKVTASARGYDPVTKTVEVDSKGGVQVN 876

Query: 216 FKL 224
F L
Sbjct: 877 FTL 879


>sp|Q00493|CBPE_MOUSE Carboxypeptidase E OS=Mus musculus GN=Cpe PE=1
SV=2
Length = 476

Score = 50.1 bits (118), Expect = 5e-06
Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
Frame = +3

Query: 24 RGTPLP-ATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGK 200
+G P+ ATISV GI+ V S K GDY RLL+PG +Y++TAS GY++ T V V
Sbjct: 384 QGNPIANATISVDGIDHDV-TSAKDGDYWRLLAPG-NYKLTASAPGYLAITKKVAVPFSP 441

Query: 201 AALLDFKLQ 227
A +DF+L+
Sbjct: 442 AVGVDFELE 450


>sp|Q4R4M3|CBPE_MACFA Carboxypeptidase E OS=Macaca fascicularis
GN=CPE PE=2 SV=1
Length = 476

Score = 50.1 bits (118), Expect = 5e-06
Identities = 33/69 (47%), Positives = 45/69 (65%), Gaps = 1/69 (1%)
Frame = +3

Query: 24 RGTPLP-ATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGK 200
+G P+ ATISV+GI+ V S K GDY RLL PG +Y++TAS GY++ T V V
Sbjct: 384 QGNPIANATISVEGIDHDV-TSAKDGDYWRLLIPG-NYKLTASAPGYLAITKKVAVPYSP 441

Query: 201 AALLDFKLQ 227
A +DF+L+
Sbjct: 442 AVGVDFELE 450


>sp|P15087|CBPE_RAT Carboxypeptidase E OS=Rattus norvegicus GN=Cpe
PE=2 SV=1
Length = 476

Score = 48.9 bits (115), Expect = 1e-05
Identities = 33/69 (47%), Positives = 44/69 (63%), Gaps = 1/69 (1%)
Frame = +3

Query: 24 RGTPLP-ATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGK 200
+G P+ ATISV GI+ V S K GDY RLL PG +Y++TAS GY++ T V V
Sbjct: 384 QGNPIANATISVDGIDHDV-TSAKDGDYWRLLVPG-NYKLTASAPGYLAITKKVAVPFSP 441

Query: 201 AALLDFKLQ 227
A +DF+L+
Sbjct: 442 AVGVDFELE 450


>sp|Q9EQV8|CBPN_RAT Carboxypeptidase N catalytic chain OS=Rattus
norvegicus GN=Cpn1 PE=2 SV=1
Length = 457

Score = 48.1 bits (113), Expect = 2e-05
Identities = 36/92 (39%), Positives = 45/92 (48%), Gaps = 9/92 (9%)
Frame = +3

Query: 42 ATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKAALLDFK 221
A ISV GIN V S ++GDY RLL PG Y VTA GY +T V V L+DF+
Sbjct: 357 AVISVTGINHDV-TSGEHGDYFRLLLPGT-YSVTAKASGYEPKTVTVTVGPAGPTLVDFQ 414

Query: 222 LQ---------PMALDHGEGASLGQNATGSQK 290
L+ A G+G+ Q T +K
Sbjct: 415 LKRSTTQVHPVQKAPGRGQGSRAKQPRTSRKK 446


tr_hit_id A7QX56
Definition tr|A7QX56|A7QX56_VITVI Chromosome undetermined scaffold_213, whole genome shotgun sequence OS=Vitis vinifera
Align length 77
Score (bit) 72.8
E-value 8.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912843|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_E05.
(463 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QX56|A7QX56_VITVI Chromosome undetermined scaffold_213, who... 73 8e-12
tr|Q84UH7|Q84UH7_ARATH SOL1 protein OS=Arabidopsis thaliana GN=s... 72 1e-11
tr|Q9M9H7|Q9M9H7_ARATH F14O23.7 protein (SOL1 protein) OS=Arabid... 72 1e-11
tr|Q84K73|Q84K73_ARATH SOL1 protein OS=Arabidopsis thaliana GN=s... 72 1e-11
tr|A9RL00|A9RL00_PHYPA Predicted protein (Fragment) OS=Physcomit... 72 1e-11
tr|B8B2M1|B8B2M1_ORYSI Putative uncharacterized protein OS=Oryza... 70 4e-11
tr|A3B8C4|A3B8C4_ORYSJ Putative uncharacterized protein OS=Oryza... 70 4e-11
tr|A1YKF5|A1YKF5_BRASY Zinc carboxy peptidase OS=Brachypodium sy... 67 3e-10
tr|B6U4B8|B6U4B8_MAIZE Putative uncharacterized protein OS=Zea m... 66 1e-09
tr|B4FM65|B4FM65_MAIZE Putative uncharacterized protein OS=Zea m... 66 1e-09
tr|B0VJI3|B0VJI3_9BACT Putative zinc-carboxypeptidase D (Metallo... 59 1e-07
tr|Q08CM1|Q08CM1_DANRE Zgc:152928 OS=Danio rerio GN=zgc:152928 P... 55 1e-06
tr|Q5SVH8|Q5SVH8_MOUSE Carboxypeptidase D OS=Mus musculus GN=Cpd... 53 7e-06
tr|A7S4K6|A7S4K6_NEMVE Predicted protein (Fragment) OS=Nematoste... 53 9e-06
tr|A1IU54|A1IU54_PIG Carboxypeptidase E OS=Sus scrofa GN=CPE PE=... 52 1e-05
tr|A9UM84|A9UM84_XENTR LOC100135269 protein (Fragment) OS=Xenopu... 52 1e-05
tr|B4DFN4|B4DFN4_HUMAN cDNA FLJ53369, highly similar to Carboxyp... 52 2e-05
tr|B3KXD3|B3KXD3_HUMAN cDNA FLJ45230 fis, clone BRCAN2021325, hi... 52 2e-05
tr|A8K4N1|A8K4N1_HUMAN cDNA FLJ76798, highly similar to Homo sap... 52 2e-05
tr|B7ZAU4|B7ZAU4_HUMAN cDNA, FLJ79308, highly similar to Carboxy... 50 4e-05
tr|B7Z843|B7Z843_HUMAN cDNA FLJ59794, highly similar to Carboxyp... 50 4e-05
tr|B7Z7T9|B7Z7T9_HUMAN cDNA FLJ50395, highly similar to Carboxyp... 50 4e-05
tr|Q5U322|Q5U322_RAT Carboxypeptidase E OS=Rattus norvegicus GN=... 50 6e-05
tr|Q543R4|Q543R4_MOUSE Putative uncharacterized protein OS=Mus m... 50 6e-05
tr|A8E4W2|A8E4W2_XENTR LOC100127580 protein OS=Xenopus tropicali... 50 7e-05
tr|A7S3G8|A7S3G8_NEMVE Predicted protein (Fragment) OS=Nematoste... 50 7e-05
tr|Q5JBI1|Q5JBI1_PAROL Carboxypeptidase H OS=Paralichthys olivac... 49 1e-04
tr|B1WBB5|B1WBB5_XENLA LOC100158417 protein OS=Xenopus laevis GN... 49 2e-04
tr|Q6NSM5|Q6NSM5_DANRE Zgc:85981 OS=Danio rerio GN=zgc:85981 PE=... 48 2e-04
tr|Q4SYZ1|Q4SYZ1_TETNG Chromosome 10 SCAF11883, whole genome sho... 48 2e-04

>tr|A7QX56|A7QX56_VITVI Chromosome undetermined scaffold_213, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00008960001 PE=4 SV=1
Length = 427

Score = 72.8 bits (177), Expect = 8e-12
Identities = 37/77 (48%), Positives = 48/77 (62%)
Frame = +3

Query: 18 SSRGTPLPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEG 197
S RG PLP I++KGIN+TV A + + DYHR L+ G YEV A+M GY S+T + +EE
Sbjct: 285 SDRGRPLPGYITIKGINYTVKAGRTFADYHRPLASGEKYEVVATMPGYKSKTTSIKLEE- 343

Query: 198 KAALLDFKLQPMALDHG 248
+DF L P L G
Sbjct: 344 -VTTVDFLLDPEVLPRG 359


>tr|Q84UH7|Q84UH7_ARATH SOL1 protein OS=Arabidopsis thaliana GN=sol1
PE=2 SV=1
Length = 489

Score = 72.4 bits (176), Expect = 1e-11
Identities = 39/78 (50%), Positives = 47/78 (60%)
Frame = +3

Query: 15 LSSRGTPLPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEE 194
+ +G PLP + VKGIN+TV A + Y DYHRLL PG+ YEVTAS GY S+T V + E
Sbjct: 347 VKDKGKPLPGLVVVKGINYTVKAHQTYADYHRLLVPGQKYEVTASSPGYKSKTTTVWLGE 406

Query: 195 GKAALLDFKLQPMALDHG 248
A DF L P G
Sbjct: 407 -NAVTADFILIPETSSRG 423


>tr|Q9M9H7|Q9M9H7_ARATH F14O23.7 protein (SOL1 protein)
OS=Arabidopsis thaliana GN=sol1 PE=2 SV=1
Length = 491

Score = 72.0 bits (175), Expect = 1e-11
Identities = 39/75 (52%), Positives = 46/75 (61%)
Frame = +3

Query: 24 RGTPLPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKA 203
+G PLP + VKGIN+TV A + Y DYHRLL PG+ YEVTAS GY S+T V + E A
Sbjct: 352 KGKPLPGLVVVKGINYTVKAHQTYADYHRLLVPGQKYEVTASSPGYKSKTTTVWLGE-NA 410

Query: 204 ALLDFKLQPMALDHG 248
DF L P G
Sbjct: 411 VTADFILIPETSSRG 425


>tr|Q84K73|Q84K73_ARATH SOL1 protein OS=Arabidopsis thaliana GN=sol1
PE=2 SV=1
Length = 499

Score = 72.0 bits (175), Expect = 1e-11
Identities = 39/75 (52%), Positives = 46/75 (61%)
Frame = +3

Query: 24 RGTPLPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKA 203
+G PLP + VKGIN+TV A + Y DYHRLL PG+ YEVTAS GY S+T V + E A
Sbjct: 360 KGKPLPGLVVVKGINYTVKAHQTYADYHRLLVPGQKYEVTASSPGYKSKTTTVWLGE-NA 418

Query: 204 ALLDFKLQPMALDHG 248
DF L P G
Sbjct: 419 VTADFILIPETSSRG 433


>tr|A9RL00|A9RL00_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_22136 PE=4 SV=1
Length = 366

Score = 72.0 bits (175), Expect = 1e-11
Identities = 36/77 (46%), Positives = 51/77 (66%)
Frame = +3

Query: 18 SSRGTPLPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEG 197
S +G PL ATI V GI+ ++ AS ++GDYHRLL+PG+ Y VTA++ GY ++T V +
Sbjct: 290 SIQGEPLAATIVVSGISHSMNASAEFGDYHRLLAPGQVYTVTANIPGYYNRTTSVFLPNN 349

Query: 198 KAALLDFKLQPMALDHG 248
A LDF L P+ + G
Sbjct: 350 SAVTLDFILDPLPSNVG 366


>tr|B8B2M1|B8B2M1_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_21609 PE=4 SV=1
Length = 482

Score = 70.5 bits (171), Expect = 4e-11
Identities = 33/66 (50%), Positives = 48/66 (72%)
Frame = +3

Query: 27 GTPLPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKAA 206
G P+P ++++KGI + AS+ YGDYHR+L+PG +YEV ASM G+ ++ ++VEE KA
Sbjct: 349 GHPIPGSLTIKGIGSEIRASRTYGDYHRMLAPGENYEVMASMEGFRTKATRIVVEE-KAV 407

Query: 207 LLDFKL 224
LDF L
Sbjct: 408 SLDFIL 413


>tr|A3B8C4|A3B8C4_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_019296 PE=4 SV=1
Length = 571

Score = 70.5 bits (171), Expect = 4e-11
Identities = 33/66 (50%), Positives = 48/66 (72%)
Frame = +3

Query: 27 GTPLPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKAA 206
G P+P ++++KGI + AS+ YGDYHR+L+PG +YEV ASM G+ ++ ++VEE KA
Sbjct: 438 GHPIPGSLTIKGIGSEIRASRTYGDYHRMLAPGENYEVMASMEGFRTKATRIVVEE-KAV 496

Query: 207 LLDFKL 224
LDF L
Sbjct: 497 SLDFIL 502


>tr|A1YKF5|A1YKF5_BRASY Zinc carboxy peptidase OS=Brachypodium
sylvaticum GN=57h21.20 PE=4 SV=1
Length = 429

Score = 67.4 bits (163), Expect = 3e-10
Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 3/100 (3%)
Frame = +3

Query: 18 SSRGTPLPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEG 197
S G P+P ++ VKGI+ + AS+ GDYHR+L+PG YEV ASM G+ ++ +++E+
Sbjct: 290 SDSGRPIPGSLMVKGIDSKISASRTLGDYHRMLAPGETYEVVASMEGFRPRSTRIVLEQ- 348

Query: 198 KAALLDFKLQPMALD---HGEGASLGQNATGSQKILYNES 308
+A LDF L P H + N G + L ES
Sbjct: 349 EAMNLDFILDPDGQKKPLHNDCGCHCDNNVGGKPFLIRES 388


>tr|B6U4B8|B6U4B8_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 315

Score = 65.9 bits (159), Expect = 1e-09
Identities = 31/72 (43%), Positives = 47/72 (65%)
Frame = +3

Query: 27 GTPLPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKAA 206
G P+P ++ +KGI+ V AS +GDYHR+++PG YEV ASM G+ ++ + +E+ +A
Sbjct: 173 GRPVPGSVMIKGIDSKVSASSTFGDYHRIVAPGETYEVVASMRGFRQKSTRIRLEQ-EAV 231

Query: 207 LLDFKLQPMALD 242
LDF L P D
Sbjct: 232 SLDFILDPDGAD 243


>tr|B4FM65|B4FM65_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 315

Score = 65.9 bits (159), Expect = 1e-09
Identities = 31/72 (43%), Positives = 47/72 (65%)
Frame = +3

Query: 27 GTPLPATISVKGINFTVFASKKYGDYHRLLSPGRDYEVTASMHGYISQTAVVLVEEGKAA 206
G P+P ++ +KGI+ V AS +GDYHR+++PG YEV ASM G+ ++ + +E+ +A
Sbjct: 173 GRPVPGSVMIKGIDSKVSASSTFGDYHRIVAPGETYEVVASMRGFRQKSTRIRLEQ-EAV 231

Query: 207 LLDFKLQPMALD 242
LDF L P D
Sbjct: 232 SLDFILDPDGAD 243