BP912854
Clone id YMU001_000023_F04
Library
Length 577
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000023_F04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTTTTTAATAAATATGTCATATTGCCAATGGGGCCTTGAGATCATTGCAATG
AAACAAATTGTCCGGATGACCACTTCTGATCAACATATTCTCCATGCAACAAGTTGTTCG
ATCTAAAGAACTTGAAACTTCCAGGCCCTTGTGGTTTATTTAATGCAAAGACTCCTTCAT
ATATATTTCCATCTCGATGAATCCACTCTCCATTTGCAAAGTTTCCAAGTGCCCAAGCTC
CACAAAACTGGCTCATGCTGTCTTTGAAATAGTATGTCCCTTTTCCATGTCTTTTGTCAT
CCAGCCATTCACCTTTGTAAAGGTCACCATTTGCGTAAGTATATGATCCAATTCCATCTT
TCTTCCCCCTCTTCCATGATCCTTCATACGAACTCTTGTTCGGATATGATAGAGTGCCAC
GTCCATTTCTTAAATTGTCGGCATATTCTCCATTGAATGTGGCACCATTGGCGAATTTGT
AAAGGCCAGGCCCTTGTTTCTTGCCCATATCATAGGCACCTTCAAAGGAGTCTCCATTGG
AATAAGTAGCCACACCTTGCCCATGTGGGATATGATC
■■Homology search results ■■ -
sp_hit_id Q6VTH5
Definition sp|Q6VTH5|RSPH1_CYPCA Radial spoke head 1 homolog OS=Cyprinus carpio
Align length 166
Score (bit) 155.0
E-value 2.0e-37
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912854|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_F04.
(563 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6VTH5|RSPH1_CYPCA Radial spoke head 1 homolog OS=Cyprinus ca... 155 2e-37
sp|Q8VIG3|RSPH1_MOUSE Radial spoke head 1 homolog OS=Mus musculu... 142 9e-34
sp|Q8WYR4|RSPH1_HUMAN Radial spoke head 1 homolog OS=Homo sapien... 141 2e-33
sp|Q9SLG9|PI5K5_ARATH Phosphatidylinositol-4-phosphate 5-kinase ... 103 6e-22
sp|Q9SFB8|PI5K6_ARATH Phosphatidylinositol-4-phosphate 5-kinase ... 102 1e-21
sp|O48709|PI5K3_ARATH Phosphatidylinositol-4-phosphate 5-kinase ... 102 1e-21
sp|Q56YP2|PI5K1_ARATH Phosphatidylinositol-4-phosphate 5-kinase ... 101 3e-21
sp|Q6EX42|PI5K1_ORYSJ Phosphatidylinositol-4-phosphate 5-kinase ... 100 6e-21
sp|Q9M1K2|PI5K4_ARATH Putative phosphatidylinositol-4-phosphate ... 99 1e-20
sp|Q9SUI2|PI5K7_ARATH Phosphatidylinositol-4-phosphate 5-kinase ... 98 2e-20
sp|Q8L796|PI5K2_ARATH Phosphatidylinositol-4-phosphate 5-kinase ... 96 1e-19
sp|Q8L850|PI5K9_ARATH Phosphatidylinositol-4-phosphate 5-kinase ... 94 6e-19
sp|Q8RY89|PI5K8_ARATH Phosphatidylinositol-4-phosphate 5-kinase ... 93 8e-19
sp|Q1JPG1|RS10B_BOVIN Radial spoke head 10 homolog B OS=Bos taur... 92 2e-18
sp|Q08CH7|RS10B_DANRE Radial spoke head 10 homolog B OS=Danio re... 90 7e-18
sp|B2RC85|R10B2_HUMAN Radial spoke head 10 homolog B2 OS=Homo sa... 89 1e-17
sp|Q5PPV3|MORN3_XENLA MORN repeat-containing protein 3 OS=Xenopu... 87 6e-17
sp|Q641X6|MORN1_RAT MORN repeat-containing protein 1 OS=Rattus n... 86 2e-16
sp|P0C881|R10B1_HUMAN Radial spoke head 10 homolog B OS=Homo sap... 85 2e-16
sp|Q66HB5|RS10B_RAT Radial spoke head 10 homolog B OS=Rattus nor... 83 1e-15
sp|Q5BIW4|ALS2_PANTR Alsin OS=Pan troglodytes GN=ALS2 PE=2 SV=1 80 5e-15
sp|Q920R0|ALS2_MOUSE Alsin OS=Mus musculus GN=Als2 PE=1 SV=2 80 5e-15
sp|Q96Q42|ALS2_HUMAN Alsin OS=Homo sapiens GN=ALS2 PE=1 SV=1 80 5e-15
sp|P0C5Y8|ALS2_RAT Alsin OS=Rattus norvegicus GN=Als2 PE=2 SV=1 80 9e-15
sp|Q5T089|MORN1_HUMAN MORN repeat-containing protein 1 OS=Homo s... 79 2e-14
sp|Q4R842|MORN3_MACFA MORN repeat-containing protein 3 OS=Macaca... 79 2e-14
sp|Q8C5T4|MORN3_MOUSE MORN repeat-containing protein 3 OS=Mus mu... 78 3e-14
sp|Q6PF18|MORN3_HUMAN MORN repeat-containing protein 3 OS=Homo s... 78 3e-14
sp|Q32KM6|MORN3_BOVIN MORN repeat-containing protein 3 OS=Bos ta... 77 4e-14
sp|Q4QQN5|SETD7_XENTR Histone-lysine N-methyltransferase SETD7 O... 74 5e-13

>sp|Q6VTH5|RSPH1_CYPCA Radial spoke head 1 homolog OS=Cyprinus
carpio GN=rsph1 PE=1 SV=1
Length = 218

Score = 155 bits (391), Expect = 2e-37
Identities = 74/166 (44%), Positives = 101/166 (60%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HGQG A GD+++GAY+ GK+ G G YKF NGA + GE+ NL++G+G L YP+ S Y
Sbjct: 30 HGQGKAVLPRGDTYQGAYENGKRCGQGTYKFKNGARYTGEWYMNLKHGQGVLYYPDGSKY 89

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFANGE 192
EGSW ++ G G YTY NGD Y GEWL +RHG+GTY +++ SQ+ G W +GN +
Sbjct: 90 EGSWVDDQRQGHGVYTYPNGDTYDGEWLHHQRHGQGTYTHQETGSQYRGTWVVGNMESTG 149

Query: 191 WIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVDQKWSSGQ 54
+ + + Y G F N P GPG + F HGEY + G+
Sbjct: 150 ELIQLNHRYHGNFVNNNPSGPGKY-VFDIGCEQHGEYFQLEPDKGE 194



Score = 72.8 bits (177), Expect = 1e-12
Identities = 35/104 (33%), Positives = 59/104 (56%), Gaps = 1/104 (0%)
Frame = -1

Query: 560 HIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNK 381
++ HGQGV Y +G +EG++ ++QG G+Y + NG T++GE+ + R+G+GT ++
Sbjct: 73 NLKHGQGVLYYPDGSKYEGSWVDDQRQGHGVYTYPNGDTYDGEWLHHQRHGQGTYTHQET 132

Query: 380 -SSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYF 252
S Y G+W G + G N Y G ++++ G G Y F
Sbjct: 133 GSQYRGTWVVGNMESTGELIQLN-HRYHGNFVNNNPSGPGKYVF 175



Score = 70.5 bits (171), Expect = 5e-12
Identities = 36/127 (28%), Positives = 70/127 (55%), Gaps = 2/127 (1%)
Frame = -1

Query: 416 RNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMS 237
R+G+G P +Y+G+++ GK+ G G+Y + NG Y GEW + +HG+G Y+ D S
Sbjct: 29 RHGQGKAVLPRGDTYQGAYENGKRCGQGTYKFKNGARYTGEWYMNLKHGQGVLYYPDG-S 87

Query: 236 QFCGAWALG-NFANGEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEY-VDQKWS 63
++ G+W +G + + +G+ Y+G + ++ G G++ + + G + V S
Sbjct: 88 KYEGSWVDDQRQGHGVYTYPNGDTYDGEWLHHQRHGQGTYTHQETGSQYRGTWVVGNMES 147

Query: 62 SGQFVSL 42
+G+ + L
Sbjct: 148 TGELIQL 154



Score = 51.6 bits (122), Expect = 3e-06
Identities = 33/106 (31%), Positives = 57/106 (53%), Gaps = 3/106 (2%)
Frame = -1

Query: 374 YEGSWKR-GKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFAN 198
YEG G++ G G GD Y+G + + KR G+GTY FK+ +++ G W + N +
Sbjct: 19 YEGDRNEAGERHGQGKAVLPRGDTYQGAYENGKRCGQGTYKFKNG-ARYTGEWYM-NLKH 76

Query: 197 GEWI--HRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVDQKW 66
G+ + + DG+ YEG + ++ QG G + + +G+ D +W
Sbjct: 77 GQGVLYYPDGSKYEGSWVDDQRQGHGVYTY------PNGDTYDGEW 116


>sp|Q8VIG3|RSPH1_MOUSE Radial spoke head 1 homolog OS=Mus musculus
GN=Rsph1 PE=1 SV=2
Length = 301

Score = 142 bits (359), Expect = 9e-34
Identities = 65/157 (41%), Positives = 90/157 (57%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G A NGD++EG+Y+ GK+ G G YKF NGA + G+Y N ++G+GT YP+ S Y
Sbjct: 31 HGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRY 90

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFANGE 192
EG W ++ G G Y Y N D Y GEW + +RHG+GTY + ++ S++ G W G
Sbjct: 91 EGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAA 150

Query: 191 WIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEY 81
+ + Y+G F P GPG + F HGEY
Sbjct: 151 ELIHLNHRYQGKFMNKNPVGPGKY-VFDIGCEQHGEY 186



Score = 70.9 bits (172), Expect = 4e-12
Identities = 35/114 (30%), Positives = 65/114 (57%), Gaps = 1/114 (0%)
Frame = -1

Query: 416 RNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMS 237
R+G G PN +YEGS++ GK+ G G+Y + NG Y G+++ +K+HG+GT+ + D S
Sbjct: 30 RHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDG-S 88

Query: 236 QFCGAWALG-NFANGEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYV 78
++ G WA G + + + + Y G + ++ G G++ + + + G +V
Sbjct: 89 RYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWV 142



Score = 57.0 bits (136), Expect = 6e-08
Identities = 36/112 (32%), Positives = 62/112 (55%), Gaps = 3/112 (2%)
Frame = -1

Query: 374 YEGSWKR-GKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG-NFA 201
YEG G++ G G NGD Y+G + KRHG+GTY FK+ +++ G +
Sbjct: 20 YEGERNEVGERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNG-ARYTGDYVKNKKHG 78

Query: 200 NGEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVD-QKWSSGQFV 48
G +I+ DG+ YEG +A ++ G G + ++ +N+ GE+ + Q+ G ++
Sbjct: 79 QGTFIYPDGSRYEGEWADDQRHGQGVY-YYVNNDTYTGEWFNHQRHGQGTYL 129


>sp|Q8WYR4|RSPH1_HUMAN Radial spoke head 1 homolog OS=Homo sapiens
GN=RSPH1 PE=2 SV=1
Length = 309

Score = 141 bits (356), Expect = 2e-33
Identities = 69/158 (43%), Positives = 93/158 (58%), Gaps = 1/158 (0%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG+G A NGD++EG+Y+ GK+ G G+YKF NGA + GEY N ++G+GT YP+ S Y
Sbjct: 31 HGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIYPDGSRY 90

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG-NFANG 195
EG W + G G Y Y N D Y GEW +RHG+GTY + ++ S++ G W G
Sbjct: 91 EGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTA 150

Query: 194 EWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEY 81
E IH + + Y+G F P GPG + F HGEY
Sbjct: 151 ELIHLN-HRYQGKFLNKNPVGPGKY-VFDVGCEQHGEY 186



Score = 75.1 bits (183), Expect = 2e-13
Identities = 45/146 (30%), Positives = 78/146 (53%), Gaps = 1/146 (0%)
Frame = -1

Query: 509 EGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSYEGSWKRGKKDGIGS 330
EG D+G+ +G G GE R+GRG PN +YEGS++ GK+ G G
Sbjct: 12 EGENDIGEYEG--------GRNEAGE-----RHGRGRARLPNGDTYEGSYEFGKRHGQGI 58

Query: 329 YTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG-NFANGEWIHRDGNIYEGVF 153
Y + NG Y GE++ +K+HG+GT+ + D S++ G WA +G + + + + Y G +
Sbjct: 59 YKFKNGARYIGEYVRNKKHGQGTFIYPDG-SRYEGEWANDLRHGHGVYYYINNDTYTGEW 117

Query: 152 ALNKPQGPGSFKFFRSNNLLHGEYVD 75
++ G G++ + + + G +V+
Sbjct: 118 FAHQRHGQGTYLYAETGSKYVGTWVN 143


>sp|Q9SLG9|PI5K5_ARATH Phosphatidylinositol-4-phosphate 5-kinase 5
OS=Arabidopsis thaliana GN=PIP5K5 PE=2 SV=1
Length = 772

Score = 103 bits (257), Expect = 6e-22
Identities = 52/151 (34%), Positives = 81/151 (53%), Gaps = 1/151 (0%)
Frame = -1

Query: 563 DHIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPN 384
D PHG G +++G + G + GK G G + + +GAT+ GE+ +G GT + P+
Sbjct: 81 DSFPHGHGKYLWTDGCMYIGDWYNGKTMGNGKFGWPSGATYEGEFKSGYMDGIGTYTGPS 140

Query: 383 KSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNF 204
+Y+G W K G G ++ANGD Y GEW + G+G Y + D S + G W G
Sbjct: 141 GDAYKGQWVMNLKHGHGVKSFANGDAYDGEWRRGLQEGQGKYQWSDG-SYYIGEWKNGTI 199

Query: 203 -ANGEWIHRDGNIYEGVFALNKPQGPGSFKF 114
G ++ +GN Y+G + P+G G+FK+
Sbjct: 200 CGKGSFVWTNGNRYDGFWDEGFPRGNGTFKW 230



Score = 85.9 bits (211), Expect = 1e-16
Identities = 40/128 (31%), Positives = 68/128 (53%)
Frame = -1

Query: 560 HIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNK 381
++ HG GV +++NGD+++G + G ++G G Y++++G+ + GE+ + G+G+ + N
Sbjct: 151 NLKHGHGVKSFANGDAYDGEWRRGLQEGQGKYQWSDGSYYIGEWKNGTICGKGSFVWTNG 210

Query: 380 SSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFA 201
+ Y+G W G G G++ + NG Y G W D GTYY GN
Sbjct: 211 NRYDGFWDEGFPRGNGTFKWDNGSFYVGHWSKDPEEMNGTYY------------PSGNEG 258

Query: 200 NGEWIHRD 177
N EW +D
Sbjct: 259 NLEWDPKD 266



Score = 46.2 bits (108), Expect = 1e-04
Identities = 35/127 (27%), Positives = 51/127 (40%), Gaps = 6/127 (4%)
Frame = -1

Query: 389 PNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG 210
PN Y G W G G Y + +G +Y G+W + K G G + + GA G
Sbjct: 70 PNGDYYTGQWYDSFPHGHGKYLWTDGCMYIGDWYNGKTMGNGKFGWPS------GATYEG 123

Query: 209 NFAN------GEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVDQKWSSGQFV 48
F + G + G+ Y+G + +N G G F +G+ D +W G
Sbjct: 124 EFKSGYMDGIGTYTGPSGDAYKGQWVMNLKHGHGVKSF------ANGDAYDGEWRRG--- 174

Query: 47 SLQ*SQG 27
LQ QG
Sbjct: 175 -LQEGQG 180


>sp|Q9SFB8|PI5K6_ARATH Phosphatidylinositol-4-phosphate 5-kinase 6
OS=Arabidopsis thaliana GN=PIP5K6 PE=2 SV=1
Length = 715

Score = 102 bits (254), Expect = 1e-21
Identities = 50/151 (33%), Positives = 82/151 (54%), Gaps = 1/151 (0%)
Frame = -1

Query: 563 DHIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPN 384
D++PHG G +++G + G + GK G G + + +GAT+ G++ + +G+GT +
Sbjct: 38 DNLPHGHGKYLWTDGCMYVGDWHRGKTMGKGRFSWPSGATYEGDFKNGYMDGKGTYIDSS 97

Query: 383 KSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNF 204
Y GSW + G G+ +Y NGD Y GEW + G G Y +K+ + + G W G
Sbjct: 98 GDLYRGSWVMNLRHGQGTKSYVNGDCYDGEWRRGLQDGHGRYQWKNE-NHYIGQWKNGLM 156

Query: 203 -ANGEWIHRDGNIYEGVFALNKPQGPGSFKF 114
NG I +GN Y+G + P+G G+F++
Sbjct: 157 NGNGTMIWSNGNRYDGSWEDGAPKGNGTFRW 187



Score = 90.9 bits (224), Expect = 4e-18
Identities = 39/110 (35%), Positives = 63/110 (57%)
Frame = -1

Query: 560 HIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNK 381
++ HGQG +Y NGD ++G + G + G G Y++ N + G++ + L NG GT+ + N
Sbjct: 108 NLRHGQGTKSYVNGDCYDGEWRRGLQDGHGRYQWKNENHYIGQWKNGLMNGNGTMIWSNG 167

Query: 380 SSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQF 231
+ Y+GSW+ G G G++ +++G Y G W D + GTYY S F
Sbjct: 168 NRYDGSWEDGAPKGNGTFRWSDGSFYVGVWSKDPKEQNGTYYPSTSSGNF 217



Score = 82.0 bits (201), Expect = 2e-15
Identities = 37/111 (33%), Positives = 61/111 (54%)
Frame = -1

Query: 548 GQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSYE 369
G+G S+GD + G++ M + G G + NG ++GE+ L++G G + N++ Y
Sbjct: 89 GKGTYIDSSGDLYRGSWVMNLRHGQGTKSYVNGDCYDGEWRRGLQDGHGRYQWKNENHYI 148

Query: 368 GSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWA 216
G WK G +G G+ ++NG+ Y G W D G GT+ + D S + G W+
Sbjct: 149 GQWKNGLMNGNGTMIWSNGNRYDGSWEDGAPKGNGTFRWSDG-SFYVGVWS 198



Score = 53.1 bits (126), Expect = 9e-07
Identities = 32/117 (27%), Positives = 52/117 (44%), Gaps = 6/117 (5%)
Frame = -1

Query: 389 PNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG 210
P+ Y G W+ G G Y + +G +Y G+W K GKG + + GA G
Sbjct: 27 PSGDFYTGQWRDNLPHGHGKYLWTDGCMYVGDWHRGKTMGKGRFSWPS------GATYEG 80

Query: 209 NFAN------GEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVDQKWSSG 57
+F N G +I G++Y G + +N G G + + ++G+ D +W G
Sbjct: 81 DFKNGYMDGKGTYIDSSGDLYRGSWVMNLRHGQG------TKSYVNGDCYDGEWRRG 131


>sp|O48709|PI5K3_ARATH Phosphatidylinositol-4-phosphate 5-kinase 3
OS=Arabidopsis thaliana GN=PIP5K3 PE=2 SV=1
Length = 705

Score = 102 bits (254), Expect = 1e-21
Identities = 50/145 (34%), Positives = 78/145 (53%), Gaps = 1/145 (0%)
Frame = -1

Query: 557 IPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKS 378
+PHG G +S+G +EG + GK G G + + +GAT+ G++ D +G GT +
Sbjct: 66 VPHGTGKYLWSDGCMYEGEWTRGKASGKGRFSWPSGATYEGQFKDGRMDGEGTFIGIDGD 125

Query: 377 SYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFA- 201
+Y G W G+K G G YANGD Y+G W + + G G Y + D +++ G W G +
Sbjct: 126 TYRGHWLWGRKHGYGEKRYANGDGYQGNWKANLQDGNGRYVWSDG-NEYVGEWKNGVISG 184

Query: 200 NGEWIHRDGNIYEGVFALNKPQGPG 126
G+ +GN Y+G++ P G G
Sbjct: 185 KGKMTWANGNRYDGLWENGAPVGKG 209



Score = 88.6 bits (218), Expect = 2e-17
Identities = 47/157 (29%), Positives = 76/157 (48%), Gaps = 1/157 (0%)
Frame = -1

Query: 524 NGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSYEGSWKRGKK 345
NGD + G G G G Y +++G + GE+ +G+G S+P+ ++YEG +K G+
Sbjct: 54 NGDLYNGGLSAGVPHGTGKYLWSDGCMYEGEWTRGKASGKGRFSWPSGATYEGQFKDGRM 113

Query: 344 DGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG-NFANGEWIHRDGNI 168
DG G++ +GD Y+G WL ++HG G + + + G W NG ++ DGN
Sbjct: 114 DGEGTFIGIDGDTYRGHWLWGRKHGYGEKRYANG-DGYQGNWKANLQDGNGRYVWSDGNE 172

Query: 167 YEGVFALNKPQGPGSFKFFRSNNLLHGEYVDQKWSSG 57
Y G + G G + +G D W +G
Sbjct: 173 YVGEWKNGVISGKGKMTW------ANGNRYDGLWENG 203



Score = 72.8 bits (177), Expect = 1e-12
Identities = 35/108 (32%), Positives = 57/108 (52%)
Frame = -1

Query: 548 GQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSYE 369
G+G +GD++ G + G+K G G ++ANG + G + NL++G G + + + Y
Sbjct: 115 GEGTFIGIDGDTYRGHWLWGRKHGYGEKRYANGDGYQGNWKANLQDGNGRYVWSDGNEYV 174

Query: 368 GSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCG 225
G WK G G G T+ANG+ Y G W + GKG + + + + G
Sbjct: 175 GEWKNGVISGKGKMTWANGNRYDGLWENGAPVGKGVLSWGEEKTSYNG 222



Score = 57.4 bits (137), Expect = 5e-08
Identities = 24/87 (27%), Positives = 46/87 (52%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G Y+NGD ++G + + G G Y +++G + GE+ + + +G+G +++ N + Y
Sbjct: 137 HGYGEKRYANGDGYQGNWKANLQDGNGRYVWSDGNEYVGEWKNGVISGKGKMTWANGNRY 196

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEW 291
+G W+ G G G ++ W
Sbjct: 197 DGLWENGAPVGKGVLSWGEEKTSYNGW 223



Score = 41.2 bits (95), Expect = 0.004
Identities = 22/73 (30%), Positives = 39/73 (53%), Gaps = 1/73 (1%)
Frame = -1

Query: 560 HIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSY-PN 384
++ G G +S+G+ + G + G G G +ANG ++G + + G+G LS+
Sbjct: 157 NLQDGNGRYVWSDGNEYVGEWKNGVISGKGKMTWANGNRYDGLWENGAPVGKGVLSWGEE 216

Query: 383 KSSYEGSWKRGKK 345
K+SY G ++ KK
Sbjct: 217 KTSYNGWGRKSKK 229


>sp|Q56YP2|PI5K1_ARATH Phosphatidylinositol-4-phosphate 5-kinase 1
OS=Arabidopsis thaliana GN=PIP5K1 PE=1 SV=1
Length = 752

Score = 101 bits (251), Expect = 3e-21
Identities = 50/146 (34%), Positives = 79/146 (54%), Gaps = 1/146 (0%)
Frame = -1

Query: 554 PHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSS 375
PHG G + +G +EG + GK G G + + +GAT+ GE+ G GT + + +
Sbjct: 90 PHGSGKYLWKDGCMYEGDWKRGKASGKGKFSWPSGATYEGEFKSGRMEGFGTFTGADGDT 149

Query: 374 YEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFA-N 198
Y G+W +K G G YANGD Y+G W + + G+G Y +++ +Q+ G W G +
Sbjct: 150 YRGTWVADRKHGHGQKRYANGDFYEGTWRRNLQDGRGRYVWRNG-NQYTGEWRSGVISGK 208

Query: 197 GEWIHRDGNIYEGVFALNKPQGPGSF 120
G + +GN YEG++ P+G G F
Sbjct: 209 GLLVWPNGNRYEGLWENGIPKGNGVF 234



Score = 75.9 bits (185), Expect = 1e-13
Identities = 41/122 (33%), Positives = 62/122 (50%), Gaps = 4/122 (3%)
Frame = -1

Query: 548 GQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSYE 369
G G T ++GD++ G + +K G G ++ANG + G + NL++GRG + N + Y
Sbjct: 138 GFGTFTGADGDTYRGTWVADRKHGHGQKRYANGDFYEGTWRRNLQDGRGRYVWRNGNQYT 197

Query: 368 GSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGN----FA 201
G W+ G G G + NG+ Y+G W + G G + + D S GAW N F
Sbjct: 198 GEWRSGVISGKGLLVWPNGNRYEGLWENGIPKGNGVFTWSDG-SSCVGAWNESNIMRSFF 256

Query: 200 NG 195
NG
Sbjct: 257 NG 258



Score = 73.9 bits (180), Expect = 5e-13
Identities = 32/87 (36%), Positives = 49/87 (56%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G Y+NGD +EG + + G G Y + NG + GE+ + +G+G L +PN + Y
Sbjct: 160 HGHGQKRYANGDFYEGTWRRNLQDGRGRYVWRNGNQYTGEWRSGVISGKGLLVWPNGNRY 219

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEW 291
EG W+ G G G +T+++G G W
Sbjct: 220 EGLWENGIPKGNGVFTWSDGSSCVGAW 246



Score = 68.6 bits (166), Expect = 2e-11
Identities = 41/134 (30%), Positives = 65/134 (48%), Gaps = 1/134 (0%)
Frame = -1

Query: 455 NGATFNGEYADNLRNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKR 276
NG + G ++ +G G + + YEG WKRGK G G +++ +G Y+GE+ +
Sbjct: 77 NGDLYIGSFSGGFPHGSGKYLWKDGCMYEGDWKRGKASGKGKFSWPSGATYEGEFKSGRM 136

Query: 275 HGKGTYYFKDSMSQFCGAW-ALGNFANGEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNN 99
G GT+ D + G W A +G+ + +G+ YEG + N G G + +R+ N
Sbjct: 137 EGFGTFTGADG-DTYRGTWVADRKHGHGQKRYANGDFYEGTWRRNLQDGRGRY-VWRNGN 194

Query: 98 LLHGEYVDQKWSSG 57
GE W SG
Sbjct: 195 QYTGE-----WRSG 203



Score = 40.8 bits (94), Expect = 0.005
Identities = 18/67 (26%), Positives = 34/67 (50%)
Frame = -1

Query: 560 HIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNK 381
++ G+G + NG+ + G + G G GL + NG + G + + + G G ++ +
Sbjct: 180 NLQDGRGRYVWRNGNQYTGEWRSGVISGKGLLVWPNGNRYEGLWENGIPKGNGVFTWSDG 239

Query: 380 SSYEGSW 360
SS G+W
Sbjct: 240 SSCVGAW 246


>sp|Q6EX42|PI5K1_ORYSJ Phosphatidylinositol-4-phosphate 5-kinase 1
OS=Oryza sativa subsp. japonica GN=PIPK1 PE=2 SV=2
Length = 801

Score = 100 bits (248), Expect = 6e-21
Identities = 54/162 (33%), Positives = 87/162 (53%), Gaps = 3/162 (1%)
Frame = -1

Query: 533 TYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSYEGSWKR 354
T NGD + G++D GPG Y + +GA ++GE+ + GRG + +P+ +SYEG ++
Sbjct: 34 TLPNGDIYVGSFDGLVPHGPGKYMWTDGALYDGEWDKSKMTGRGLIQWPSGASYEGDFRG 93

Query: 353 GKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG---NFANGEWIH 183
G DG G++ +G +YKG W +K+HG GT + +S + G W G F W
Sbjct: 94 GFIDGAGTFKGVDGSVYKGSWRMNKKHGMGTMVYSNS-DTYEGFWNEGLPDEFGKYTW-- 150

Query: 182 RDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVDQKWSSG 57
DGN+Y G + K G G ++ ++G+ +D W +G
Sbjct: 151 ADGNVYIGRWKSGKMNGSGVMQW------INGDTLDCNWLNG 186



Score = 85.9 bits (211), Expect = 1e-16
Identities = 46/145 (31%), Positives = 74/145 (51%), Gaps = 2/145 (1%)
Frame = -1

Query: 548 GQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSYE 369
G+G+ + +G S+EG + G G G +K +G+ + G + N ++G GT+ Y N +YE
Sbjct: 75 GRGLIQWPSGASYEGDFRGGFIDGAGTFKGVDGSVYKGSWRMNKKHGMGTMVYSNSDTYE 134

Query: 368 GSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFANGEW 189
G W G D G YT+A+G++Y G W K +G G + + + C W L A+G+
Sbjct: 135 GFWNEGLPDEFGKYTWADGNVYIGRWKSGKMNGSGVMQWINGDTLDCN-W-LNGLAHGKG 192

Query: 188 I--HRDGNIYEGVFALNKPQGPGSF 120
+ G Y G + G G+F
Sbjct: 193 YCKYASGACYIGTWDRGLKDGHGTF 217



Score = 68.9 bits (167), Expect = 2e-11
Identities = 33/99 (33%), Positives = 49/99 (49%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G YSN D++EG ++ G G Y +A+G + G + NG G + + N +
Sbjct: 120 HGMGTMVYSNSDTYEGFWNEGLPDEFGKYTWADGNVYIGRWKSGKMNGSGVMQWINGDTL 179

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYY 255
+ +W G G G YA+G Y G W + G GT+Y
Sbjct: 180 DCNWLNGLAHGKGYCKYASGACYIGTWDRGLKDGHGTFY 218



Score = 56.6 bits (135), Expect = 8e-08
Identities = 25/77 (32%), Positives = 45/77 (58%)
Frame = -1

Query: 557 IPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKS 378
+P G T+++G+ + G + GK G G+ ++ NG T + + + L +G+G Y + +
Sbjct: 141 LPDEFGKYTWADGNVYIGRWKSGKMNGSGVMQWINGDTLDCNWLNGLAHGKGYCKYASGA 200

Query: 377 SYEGSWKRGKKDGIGSY 327
Y G+W RG KDG G++
Sbjct: 201 CYIGTWDRGLKDGHGTF 217



Score = 39.7 bits (91), Expect = 0.010
Identities = 19/55 (34%), Positives = 30/55 (54%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYP 387
+G GV + NGD+ + + G G G K+A+GA + G + L++G GT P
Sbjct: 166 NGSGVMQWINGDTLDCNWLNGLAHGKGYCKYASGACYIGTWDRGLKDGHGTFYQP 220


>sp|Q9M1K2|PI5K4_ARATH Putative phosphatidylinositol-4-phosphate
5-kinase 4 OS=Arabidopsis thaliana GN=PIP5K4 PE=1 SV=1
Length = 779

Score = 99.0 bits (245), Expect = 1e-20
Identities = 51/151 (33%), Positives = 79/151 (52%), Gaps = 1/151 (0%)
Frame = -1

Query: 563 DHIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPN 384
D PHG G +++G + G + GK G G + + +GAT+ GE+ +G G + P+
Sbjct: 83 DSFPHGHGKYLWTDGCMYIGDWYNGKTMGRGKFGWPSGATYEGEFKSGYMDGVGLYTGPS 142

Query: 383 KSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNF 204
+Y+G W K G G +ANGD+Y GEW + +G Y ++D S + G W
Sbjct: 143 GDTYKGQWVMNLKHGHGIKRFANGDVYDGEWRRGLQEAQGKYQWRDG-SYYMGEWKNATI 201

Query: 203 -ANGEWIHRDGNIYEGVFALNKPQGPGSFKF 114
G +I DGN Y+G + P+G G+FK+
Sbjct: 202 CGKGTFIWTDGNRYDGFWDDGFPRGNGTFKW 232



Score = 87.8 bits (216), Expect = 3e-17
Identities = 45/144 (31%), Positives = 78/144 (54%), Gaps = 1/144 (0%)
Frame = -1

Query: 548 GQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSYE 369
G+G + +G ++EG + G G GLY +G T+ G++ NL++G G + N Y+
Sbjct: 111 GRGKFGWPSGATYEGEFKSGYMDGVGLYTGPSGDTYKGQWVMNLKHGHGIKRFANGDVYD 170

Query: 368 GSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG-NFANGE 192
G W+RG ++ G Y + +G Y GEW + GKGT+ + D +++ G W G NG
Sbjct: 171 GEWRRGLQEAQGKYQWRDGSYYMGEWKNATICGKGTFIWTDG-NRYDGFWDDGFPRGNGT 229

Query: 191 WIHRDGNIYEGVFALNKPQGPGSF 120
+ DG+ Y G ++ + + G++
Sbjct: 230 FKWADGSFYVGHWSNDPEEMNGTY 253



Score = 78.6 bits (192), Expect = 2e-14
Identities = 32/102 (31%), Positives = 59/102 (57%)
Frame = -1

Query: 560 HIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNK 381
++ HG G+ ++NGD ++G + G ++ G Y++ +G+ + GE+ + G+GT + +
Sbjct: 153 NLKHGHGIKRFANGDVYDGEWRRGLQEAQGKYQWRDGSYYMGEWKNATICGKGTFIWTDG 212

Query: 380 SSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYY 255
+ Y+G W G G G++ +A+G Y G W +D GTYY
Sbjct: 213 NRYDGFWDDGFPRGNGTFKWADGSFYVGHWSNDPEEMNGTYY 254



Score = 48.1 bits (113), Expect = 3e-05
Identities = 35/127 (27%), Positives = 54/127 (42%), Gaps = 6/127 (4%)
Frame = -1

Query: 389 PNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG 210
PN Y G W G G Y + +G +Y G+W + K G+G + + GA G
Sbjct: 72 PNGDYYTGQWYDSFPHGHGKYLWTDGCMYIGDWYNGKTMGRGKFGWPS------GATYEG 125

Query: 209 NFANGE------WIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVDQKWSSGQFV 48
F +G + G+ Y+G + +N G G +F +G+ D +W G
Sbjct: 126 EFKSGYMDGVGLYTGPSGDTYKGQWVMNLKHGHGIKRF------ANGDVYDGEWRRG--- 176

Query: 47 SLQ*SQG 27
LQ +QG
Sbjct: 177 -LQEAQG 182


>sp|Q9SUI2|PI5K7_ARATH Phosphatidylinositol-4-phosphate 5-kinase 7
OS=Arabidopsis thaliana GN=PIP5K7 PE=2 SV=1
Length = 754

Score = 98.2 bits (243), Expect = 2e-20
Identities = 47/149 (31%), Positives = 84/149 (56%), Gaps = 1/149 (0%)
Frame = -1

Query: 557 IPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKS 378
IP+G+G +S+G +EG +D GK G G +++GA + G+++ +G GT++ P++S
Sbjct: 24 IPNGKGKYAWSDGTIYEGDWDEGKISGKGKLIWSSGAKYEGDFSGGYLHGFGTMTSPDES 83

Query: 377 SYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFA- 201
Y G+W+ + G+G Y N DLY G W + + G+G+Y + + +++ G W G
Sbjct: 84 VYSGAWRMNVRHGLGRKEYCNSDLYDGLWKEGLQDGRGSYSWTNG-NRYIGNWKKGKMCE 142

Query: 200 NGEWIHRDGNIYEGVFALNKPQGPGSFKF 114
G +G++Y+G + G G +KF
Sbjct: 143 RGVMRWENGDLYDGFWLNGFRHGSGVYKF 171



Score = 87.0 bits (214), Expect = 6e-17
Identities = 42/114 (36%), Positives = 63/114 (55%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G T + + GA+ M + G G ++ N ++G + + L++GRG+ S+ N + Y
Sbjct: 72 HGFGTMTSPDESVYSGAWRMNVRHGLGRKEYCNSDLYDGLWKEGLQDGRGSYSWTNGNRY 131

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG 210
G+WK+GK G + NGDLY G WL+ RHG G Y F D + G W+ G
Sbjct: 132 IGNWKKGKMCERGVMRWENGDLYDGFWLNGFRHGSGVYKFADGCLYY-GTWSRG 184



Score = 73.9 bits (180), Expect = 5e-13
Identities = 34/102 (33%), Positives = 51/102 (50%)
Frame = -1

Query: 560 HIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNK 381
++ HG G Y N D ++G + G + G G Y + NG + G + RG + + N
Sbjct: 92 NVRHGLGRKEYCNSDLYDGLWKEGLQDGRGSYSWTNGNRYIGNWKKGKMCERGVMRWENG 151

Query: 380 SSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYY 255
Y+G W G + G G Y +A+G LY G W + GKG +Y
Sbjct: 152 DLYDGFWLNGFRHGSGVYKFADGCLYYGTWSRGLKDGKGVFY 193



Score = 64.3 bits (155), Expect = 4e-10
Identities = 35/125 (28%), Positives = 62/125 (49%), Gaps = 1/125 (0%)
Frame = -1

Query: 464 KFANGATFNGEYADNLRNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLD 285
+F NG ++GE + NG+G ++ + + YEG W GK G G +++G Y+G++
Sbjct: 9 EFPNGDFYSGEVKGIIPNGKGKYAWSDGTIYEGDWDEGKISGKGKLIWSSGAKYEGDFSG 68

Query: 284 DKRHGKGTYYFKDSMSQFCGAWALG-NFANGEWIHRDGNIYEGVFALNKPQGPGSFKFFR 108
HG GT D S + GAW + G + + ++Y+G++ G GS+ +
Sbjct: 69 GYLHGFGTMTSPDE-SVYSGAWRMNVRHGLGRKEYCNSDLYDGLWKEGLQDGRGSYSWTN 127

Query: 107 SNNLL 93
N +
Sbjct: 128 GNRYI 132



Score = 47.4 bits (111), Expect = 5e-05
Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 7/123 (5%)
Frame = -1

Query: 404 GTLSYPNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCG 225
G +PN Y G K +G G Y +++G +Y+G+W + K GKG + G
Sbjct: 6 GDREFPNGDFYSGEVKGIIPNGKGKYAWSDGTIYEGDWDEGKISGKGKLIWSS------G 59

Query: 224 AWALGNFANGEWIH-------RDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVDQKW 66
A G+F+ G ++H D ++Y G + +N G G ++ S + D W
Sbjct: 60 AKYEGDFSGG-YLHGFGTMTSPDESVYSGAWRMNVRHGLGRKEYCNS------DLYDGLW 112

Query: 65 SSG 57
G
Sbjct: 113 KEG 115


tr_hit_id A9S698
Definition tr|A9S698|A9S698_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 136
Score (bit) 166.0
E-value 1.0e-39
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912854|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_F04.
(563 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9S698|A9S698_PHYPA Predicted protein (Fragment) OS=Physcomit... 166 1e-39
tr|A9SH85|A9SH85_PHYPA Predicted protein (Fragment) OS=Physcomit... 156 6e-37
tr|Q4S9U7|Q4S9U7_TETNG Chromosome undetermined SCAF14694, whole ... 152 1e-35
tr|B5XBN8|B5XBN8_SALSA Radial spoke head 1 homolog OS=Salmo sala... 151 3e-35
tr|A7T9S6|A7T9S6_NEMVE Predicted protein (Fragment) OS=Nematoste... 151 3e-35
tr|A0DZE9|A0DZE9_PARTE Chromosome undetermined scaffold_70, whol... 149 8e-35
tr|A0E470|A0E470_PARTE Chromosome undetermined scaffold_78, whol... 147 3e-34
tr|A7SRL1|A7SRL1_NEMVE Predicted protein (Fragment) OS=Nematoste... 147 4e-34
tr|Q3YEA6|Q3YEA6_MOUSE TSGA2 OS=Mus musculus GN=Rsph1 PE=2 SV=1 144 3e-33
tr|Q3YEA4|Q3YEA4_MOUSE TSGA2 OS=Mus musculus GN=Rsph1 PE=2 SV=1 142 1e-32
tr|Q3YEA2|Q3YEA2_MOUSE TSGA2 OS=Mus musculus GN=Rsph1 PE=2 SV=1 142 1e-32
tr|Q3YEA1|Q3YEA1_MOUSE TSGA2 OS=Mus musculus GN=Rsph1 PE=2 SV=1 142 1e-32
tr|A7S069|A7S069_NEMVE Predicted protein OS=Nematostella vectens... 142 1e-32
tr|A7SAB7|A7SAB7_NEMVE Predicted protein OS=Nematostella vectens... 142 2e-32
tr|Q5XFW9|Q5XFW9_RAT Radial spoke head 1 homolog (Chlamydomonas)... 141 2e-32
tr|B2RBN9|B2RBN9_HUMAN cDNA, FLJ95609, Homo sapiens testes speci... 141 2e-32
tr|B6KHU1|B6KHU1_TOXGO MORN repeat protein, putative OS=Toxoplas... 141 3e-32
tr|Q3YEA3|Q3YEA3_MUSSP TSGA2 OS=Mus spretus GN=Tsga2 PE=2 SV=1 139 1e-31
tr|B6MNU9|B6MNU9_BRAFL Putative uncharacterized protein OS=Branc... 138 2e-31
tr|A9V1N8|A9V1N8_MONBE Predicted protein OS=Monosiga brevicollis... 137 3e-31
tr|A0CKI9|A0CKI9_PARTE Chromosome undetermined scaffold_2, whole... 135 1e-30
tr|A7RTQ4|A7RTQ4_NEMVE Predicted protein (Fragment) OS=Nematoste... 135 2e-30
tr|B3RTM5|B3RTM5_TRIAD Putative uncharacterized protein OS=Trich... 134 3e-30
tr|A7RNN9|A7RNN9_NEMVE Predicted protein (Fragment) OS=Nematoste... 134 3e-30
tr|A0CNM9|A0CNM9_PARTE Chromosome undetermined scaffold_22, whol... 134 4e-30
tr|Q5PPX1|Q5PPX1_XENLA LOC496054 protein OS=Xenopus laevis GN=rs... 132 1e-29
tr|Q23K31|Q23K31_TETTH Putative uncharacterized protein OS=Tetra... 129 8e-29
tr|Q5D9Y0|Q5D9Y0_SCHJA SJCHGC09106 protein OS=Schistosoma japoni... 129 1e-28
tr|B5D315|B5D315_9BACE Putative uncharacterized protein OS=Bacte... 127 3e-28
tr|A7SGU9|A7SGU9_NEMVE Predicted protein OS=Nematostella vectens... 127 3e-28

>tr|A9S698|A9S698_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_37488 PE=4 SV=1
Length = 142

Score = 166 bits (419), Expect = 1e-39
Identities = 72/136 (52%), Positives = 97/136 (71%), Gaps = 1/136 (0%)
Frame = -1

Query: 563 DHIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFA-NGATFNGEYADNLRNGRGTLSYP 387
D P G G+ATY NGD FEG+Y GK+ G G Y F + AT+ G Y DN + G GT+S+P
Sbjct: 7 DFEPVGPGIATYPNGDIFEGSYYGGKRHGFGKYTFTKDAATYEGNYTDNQKAGFGTMSFP 66

Query: 386 NKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGN 207
+KSSY GSW + K+ G G YTY NGD+YKG+W ++K+HG G+Y+FK+ M+QF G W G
Sbjct: 67 DKSSYTGSWYQDKRSGEGQYTYKNGDIYKGQWFENKKHGVGSYFFKNDMAQFIGIWEKGF 126

Query: 206 FANGEWIHRDGNIYEG 159
FA G+W+ ++G+ YEG
Sbjct: 127 FAKGKWLFKNGDFYEG 142



Score = 69.3 bits (168), Expect = 1e-10
Identities = 37/105 (35%), Positives = 63/105 (60%), Gaps = 2/105 (1%)
Frame = -1

Query: 410 GRGTLSYPNKSSYEGSWKRGKKDGIGSYTYA-NGDLYKGEWLDDKRHGKGTYYFKDSMSQ 234
G G +YPN +EGS+ GK+ G G YT+ + Y+G + D+++ G GT F D S
Sbjct: 12 GPGIATYPNGDIFEGSYYGGKRHGFGKYTFTKDAATYEGNYTDNQKAGFGTMSFPDK-SS 70

Query: 233 FCGAWALGNFAN-GEWIHRDGNIYEGVFALNKPQGPGSFKFFRSN 102
+ G+W + G++ +++G+IY+G + NK G GS+ FF+++
Sbjct: 71 YTGSWYQDKRSGEGQYTYKNGDIYKGQWFENKKHGVGSY-FFKND 114



Score = 43.5 bits (101), Expect = 0.008
Identities = 27/97 (27%), Positives = 40/97 (41%)
Frame = -1

Query: 341 GIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFANGEWIHRDGNIYE 162
G G TY NGD+++G + KRHG G Y F +D YE
Sbjct: 12 GPGIATYPNGDIFEGSYYGGKRHGFGKYTFT----------------------KDAATYE 49

Query: 161 GVFALNKPQGPGSFKFFRSNNLLHGEYVDQKWSSGQF 51
G + N+ G G+ F ++ Y D++ GQ+
Sbjct: 50 GNYTDNQKAGFGTMSFPDKSSYTGSWYQDKRSGEGQY 86


>tr|A9SH85|A9SH85_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_37529 PE=4 SV=1
Length = 144

Score = 156 bits (395), Expect = 6e-37
Identities = 70/135 (51%), Positives = 92/135 (68%), Gaps = 2/135 (1%)
Frame = -1

Query: 557 IPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKS 378
+P+G G ATYSNGDSFEG+YD K+ G G Y +ANGA + G Y+ N + G G + YP++S
Sbjct: 10 MPYGPGKATYSNGDSFEGSYDDMKRNGIGKYIYANGAEYEGSYSQNQKTGYGVMKYPDQS 69

Query: 377 SY--EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNF 204
+ G+W R K G G Y Y N D+YKGEW ++ RHG GTY+F SMSQF G W G F
Sbjct: 70 GFVRAGAWFRDLKHGEGKYIYPNQDIYKGEWKNNIRHGTGTYFFAMSMSQFIGTWLDGKF 129

Query: 203 ANGEWIHRDGNIYEG 159
G+W+ R+G++YEG
Sbjct: 130 IAGQWVFRNGDVYEG 144



Score = 75.5 bits (184), Expect = 2e-12
Identities = 46/146 (31%), Positives = 70/146 (47%), Gaps = 2/146 (1%)
Frame = -1

Query: 479 GPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYAN--GDL 306
GPG ++NG +F G Y D RNG G Y N + YEGS+ + +K G G Y + G +
Sbjct: 13 GPGKATYSNGDSFEGSYDDMKRNGIGKYIYANGAEYEGSYSQNQKTGYGVMKYPDQSGFV 72

Query: 305 YKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFANGEWIHRDGNIYEGVFALNKPQGPG 126
G W D +HG+G Y I+ + +IY+G + N G G
Sbjct: 73 RAGAWFRDLKHGEGKY-----------------------IYPNQDIYKGEWKNNIRHGTG 109

Query: 125 SFKFFRSNNLLHGEYVDQKWSSGQFV 48
++ F S + G ++D K+ +GQ+V
Sbjct: 110 TYFFAMSMSQFIGTWLDGKFIAGQWV 135


>tr|Q4S9U7|Q4S9U7_TETNG Chromosome undetermined SCAF14694, whole
genome shotgun sequence. (Fragment) OS=Tetraodon
nigroviridis GN=GSTENG00021734001 PE=4 SV=1
Length = 343

Score = 152 bits (384), Expect = 1e-35
Identities = 73/158 (46%), Positives = 99/158 (62%), Gaps = 1/158 (0%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G A +NGD ++G Y+ GK+ G G Y+F NG+ + G Y +NL+NG G YP+ S Y
Sbjct: 186 HGVGRAVLANGDIYQGHYEYGKRHGQGTYRFKNGSRYVGNYQENLKNGEGIFYYPDGSRY 245

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNF-ANG 195
EGSW + ++G G YTY NGD Y+GEWL+ RHG+G Y++ + SQ+ G+W G G
Sbjct: 246 EGSWVKDMREGHGVYTYPNGDTYEGEWLNHLRHGQGVYHYHATGSQYNGSWVDGKMELGG 305

Query: 194 EWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEY 81
E+IH + Y+G F+ N P GPG F F HGEY
Sbjct: 306 EYIH-SNHRYKGNFSNNNPCGPGKF-VFDIGCEQHGEY 341



Score = 141 bits (356), Expect = 2e-32
Identities = 69/158 (43%), Positives = 95/158 (60%), Gaps = 1/158 (0%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G A ++GD ++G Y GK+ G G Y F N + + G+Y NL++G G YP+ S Y
Sbjct: 13 HGGGRAVLASGDIYQGQYKNGKRHGKGTYHFKNSSRYVGDYQQNLKHGEGIFYYPDGSRY 72

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNF-ANG 195
EGSW + ++G G YTY NGD Y+GEWL+ RHG+G Y++ + SQ+ G+W G G
Sbjct: 73 EGSWVKDMREGHGVYTYPNGDTYEGEWLNHMRHGQGVYHYTTTGSQYRGSWVDGKMELGG 132

Query: 194 EWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEY 81
E+IH + Y+G F+ N P G G F F HGEY
Sbjct: 133 EYIH-SNHRYKGNFSNNNPCGSGKF-VFDIGCEQHGEY 168



Score = 83.6 bits (205), Expect = 7e-15
Identities = 47/162 (29%), Positives = 80/162 (49%), Gaps = 13/162 (8%)
Frame = -1

Query: 560 HIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNK 381
++ HG+G+ Y +G +EG++ ++G G+Y + NG T+ GE+ +++R+G+G Y
Sbjct: 56 NLKHGEGIFYYPDGSRYEGSWVKDMREGHGVYTYPNGDTYEGEWLNHMRHGQGVYHYTTT 115

Query: 380 -SSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNF 204
S Y GSW GK + G Y ++N YKG + ++ G G + F Q +
Sbjct: 116 GSQYRGSWVDGKMELGGEYIHSN-HRYKGNFSNNNPCGSGKFVFDIGCEQHGEYQQIQQE 174

Query: 203 ANGEWIHRD------------GNIYEGVFALNKPQGPGSFKF 114
GE D G+IY+G + K G G+++F
Sbjct: 175 YEGERNEADERHGVGRAVLANGDIYQGHYEYGKRHGQGTYRF 216



Score = 77.0 bits (188), Expect = 6e-13
Identities = 52/205 (25%), Positives = 93/205 (45%), Gaps = 36/205 (17%)
Frame = -1

Query: 563 DHIPHGQGVATYSN-GDSFEGAYDMGKKQ----------------------GPGLYKFAN 453
+H+ HGQGV Y+ G + G++ GK + G G + F
Sbjct: 101 NHMRHGQGVYHYTTTGSQYRGSWVDGKMELGGEYIHSNHRYKGNFSNNNPCGSGKFVFDI 160

Query: 452 GATFNGEYAD------------NLRNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYANGD 309
G +GEY + R+G G N Y+G ++ GK+ G G+Y + NG
Sbjct: 161 GCEQHGEYQQIQQEYEGERNEADERHGVGRAVLANGDIYQGHYEYGKRHGQGTYRFKNGS 220

Query: 308 LYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG-NFANGEWIHRDGNIYEGVFALNKPQG 132
Y G + ++ ++G+G +Y+ D S++ G+W +G + + +G+ YEG + + G
Sbjct: 221 RYVGNYQENLKNGEGIFYYPDG-SRYEGSWVKDMREGHGVYTYPNGDTYEGEWLNHLRHG 279

Query: 131 PGSFKFFRSNNLLHGEYVDQKWSSG 57
G + + + + +G +VD K G
Sbjct: 280 QGVYHYHATGSQYNGSWVDGKMELG 304



Score = 73.6 bits (179), Expect = 7e-12
Identities = 35/105 (33%), Positives = 62/105 (59%), Gaps = 1/105 (0%)
Frame = -1

Query: 563 DHIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSY-P 387
+++ +G+G+ Y +G +EG++ ++G G+Y + NG T+ GE+ ++LR+G+G Y
Sbjct: 228 ENLKNGEGIFYYPDGSRYEGSWVKDMREGHGVYTYPNGDTYEGEWLNHLRHGQGVYHYHA 287

Query: 386 NKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYF 252
S Y GSW GK + G Y ++N YKG + ++ G G + F
Sbjct: 288 TGSQYNGSWVDGKMELGGEYIHSN-HRYKGNFSNNNPCGPGKFVF 331



Score = 67.8 bits (164), Expect = 4e-10
Identities = 34/121 (28%), Positives = 63/121 (52%), Gaps = 1/121 (0%)
Frame = -1

Query: 416 RNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMS 237
R+G G + Y+G +K GK+ G G+Y + N Y G++ + +HG+G +Y+ D S
Sbjct: 12 RHGGGRAVLASGDIYQGQYKNGKRHGKGTYHFKNSSRYVGDYQQNLKHGEGIFYYPDG-S 70

Query: 236 QFCGAWALG-NFANGEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVDQKWSS 60
++ G+W +G + + +G+ YEG + + G G + + + + G +VD K
Sbjct: 71 RYEGSWVKDMREGHGVYTYPNGDTYEGEWLNHMRHGQGVYHYTTTGSQYRGSWVDGKMEL 130

Query: 59 G 57
G
Sbjct: 131 G 131



Score = 61.2 bits (147), Expect = 4e-08
Identities = 40/117 (34%), Positives = 66/117 (56%), Gaps = 11/117 (9%)
Frame = -1

Query: 374 YEGSWKR-GKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFAN 198
YEG G++ G G A+GD+Y+G++ + KRHGKGTY+FK+S S++ G + N +
Sbjct: 2 YEGERNEAGERHGGGRAVLASGDIYQGQYKNGKRHGKGTYHFKNS-SRYVGDYQ-QNLKH 59

Query: 197 GEWI--HRDGNIYEGVFALNKPQGPGSFKFFRS--------NNLLHGEYVDQKWSSG 57
GE I + DG+ YEG + + +G G + + N++ HG+ V ++G
Sbjct: 60 GEGIFYYPDGSRYEGSWVKDMREGHGVYTYPNGDTYEGEWLNHMRHGQGVYHYTTTG 116


>tr|B5XBN8|B5XBN8_SALSA Radial spoke head 1 homolog OS=Salmo salar
GN=RSPH1 PE=2 SV=1
Length = 248

Score = 151 bits (381), Expect = 3e-35
Identities = 74/163 (45%), Positives = 102/163 (62%), Gaps = 3/163 (1%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G A NGD+++G Y+ GK+ G G Y+F NGA + GEY NL++G G YP+ S Y
Sbjct: 30 HGVGRAVLPNGDTYQGMYENGKRSGQGTYRFKNGARYIGEYYQNLKHGHGIFYYPDGSKY 89

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFAN-G 195
EGSW ++ G G YTY N D Y+GEWL +R+G+G Y++ D+ S++ G W +G + G
Sbjct: 90 EGSWVDDQRQGHGLYTYPNQDTYEGEWLHHQRNGQGIYHYNDTGSRYMGTWVMGKMESAG 149

Query: 194 EWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEY--VDQ 72
E+IH + + Y+G F N P GPG + F HGEY VDQ
Sbjct: 150 EFIHLN-HRYQGNFLNNNPSGPGKY-VFEIGCEQHGEYLQVDQ 190



Score = 75.9 bits (185), Expect = 1e-12
Identities = 37/110 (33%), Positives = 61/110 (55%), Gaps = 1/110 (0%)
Frame = -1

Query: 560 HIPHGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNK 381
++ HG G+ Y +G +EG++ ++QG GLY + N T+ GE+ + RNG+G Y +
Sbjct: 73 NLKHGHGIFYYPDGSKYEGSWVDDQRQGHGLYTYPNQDTYEGEWLHHQRNGQGIYHYNDT 132

Query: 380 SS-YEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQ 234
S Y G+W GK + G + + N Y+G +L++ G G Y F+ Q
Sbjct: 133 GSRYMGTWVMGKMESAGEFIHLN-HRYQGNFLNNNPSGPGKYVFEIGCEQ 181



Score = 69.3 bits (168), Expect = 1e-10
Identities = 43/151 (28%), Positives = 78/151 (51%), Gaps = 7/151 (4%)
Frame = -1

Query: 473 GLYKFANGATFNGEYADNL-----RNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYANGD 309
G F + + GEY + R+G G PN +Y+G ++ GK+ G G+Y + NG
Sbjct: 5 GSEDFDDDQGYLGEYEGDRNEAGERHGVGRAVLPNGDTYQGMYENGKRSGQGTYRFKNGA 64

Query: 308 LYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG-NFANGEWIHRDGNIYEGVFALNKPQG 132
Y GE+ + +HG G +Y+ D S++ G+W +G + + + + YEG + ++ G
Sbjct: 65 RYIGEYYQNLKHGHGIFYYPDG-SKYEGSWVDDQRQGHGLYTYPNQDTYEGEWLHHQRNG 123

Query: 131 PGSFKFFRSNNLLHGEYVDQKW-SSGQFVSL 42
G + + + + G +V K S+G+F+ L
Sbjct: 124 QGIYHYNDTGSRYMGTWVMGKMESAGEFIHL 154


>tr|A7T9S6|A7T9S6_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g3983 PE=4 SV=1
Length = 169

Score = 151 bits (381), Expect = 3e-35
Identities = 65/146 (44%), Positives = 89/146 (60%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G A ++GD+++G Y+ GK+ G G+Y+F N A + GEY +N R G GT+ +P+ S Y
Sbjct: 14 HGYGTALLTSGDTYQGLYNNGKRHGYGIYRFVNKARYEGEYVNNKREGTGTMYFPDGSMY 73

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFANGE 192
+G WK K+ G G Y YANGD Y+GEW +RHG+G Y +KD + G WA G F
Sbjct: 74 KGEWKNNKRSGNGKYKYANGDTYEGEWKLGRRHGQGVYVYKDLGISYKGNWAFGKFDGKG 133

Query: 191 WIHRDGNIYEGVFALNKPQGPGSFKF 114
+H +Y G F P+GPG F F
Sbjct: 134 QVHTPYYVYNGTFYDETPRGPGRFSF 159



Score = 71.6 bits (174), Expect = 3e-11
Identities = 36/105 (34%), Positives = 58/105 (55%), Gaps = 1/105 (0%)
Frame = -1

Query: 425 DNLRNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKD 246
D R+G GT + +Y+G + GK+ G G Y + N Y+GE++++KR G GT YF D
Sbjct: 10 DGERHGYGTALLTSGDTYQGLYNNGKRHGYGIYRFVNKARYEGEYVNNKREGTGTMYFPD 69

Query: 245 SMSQFCGAWALG-NFANGEWIHRDGNIYEGVFALNKPQGPGSFKF 114
S + G W NG++ + +G+ YEG + L + G G + +
Sbjct: 70 G-SMYKGEWKNNKRSGNGKYKYANGDTYEGEWKLGRRHGQGVYVY 113


>tr|A0DZE9|A0DZE9_PARTE Chromosome undetermined scaffold_70, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00021583001 PE=4 SV=1
Length = 209

Score = 149 bits (377), Expect = 8e-35
Identities = 68/153 (44%), Positives = 95/153 (62%), Gaps = 2/153 (1%)
Frame = -1

Query: 548 GQGVATYSNGDSFEGAYDMGKKQGPGLYKF-ANGATFNGEYADNLRNGRGTLSYPN-KSS 375
G+G+ATY NGD++EG Y G ++G G Y + +G + GE+ NL++G G L Y N K
Sbjct: 26 GKGIATYPNGDTYEGQYVNGIREGKGKYTYNPSGDKYEGEFLQNLKHGIGRLIYANNKGE 85

Query: 374 YEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFANG 195
Y G W++G + G G YTYAN D+Y G+W K+HG+GTY F D+ +F G W +G
Sbjct: 86 YYGQWEQGLRHGEGLYTYANKDVYSGQWSRGKKHGQGTYVFNDTAMRFRGTWNNNEIVDG 145

Query: 194 EWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNL 96
EWI+ +G +Y G F NKP G G F+F N +
Sbjct: 146 EWIYPNGTVYRGPFQHNKPNGVGRFEFANKNQV 178



Score = 59.7 bits (143), Expect = 1e-07
Identities = 31/86 (36%), Positives = 48/86 (55%), Gaps = 1/86 (1%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGA-TFNGEYADNLRNGRGTLSYPNKSS 375
HG+G+ TY+N D + G + GKK G G Y F + A F G + +N G YPN +
Sbjct: 96 HGEGLYTYANKDVYSGQWSRGKKHGQGTYVFNDTAMRFRGTWNNN-EIVDGEWIYPNGTV 154

Query: 374 YEGSWKRGKKDGIGSYTYANGDLYKG 297
Y G ++ K +G+G + +AN + +G
Sbjct: 155 YRGPFQHNKPNGVGRFEFANKNQVEG 180


>tr|A0E470|A0E470_PARTE Chromosome undetermined scaffold_78, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00023261001 PE=4 SV=1
Length = 209

Score = 147 bits (372), Expect = 3e-34
Identities = 68/153 (44%), Positives = 94/153 (61%), Gaps = 2/153 (1%)
Frame = -1

Query: 548 GQGVATYSNGDSFEGAYDMGKKQGPGLYKF-ANGATFNGEYADNLRNGRGTLSYPN-KSS 375
G+G ATY NGD +EG Y G ++G G Y + +G + GE+ +NL++G G L Y N K
Sbjct: 26 GKGTATYPNGDIYEGQYVNGVREGKGKYTYNPSGDKYEGEFQENLKHGIGRLIYSNNKGE 85

Query: 374 YEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFANG 195
Y G W++G + G G YTYAN D+Y G+W K+HG+GTY F D+ +F G W +G
Sbjct: 86 YYGQWEQGLRHGEGLYTYANKDVYSGQWSRGKKHGQGTYVFNDTAMRFRGTWNNNEIVDG 145

Query: 194 EWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNL 96
EWI+ +G +Y G F NKP G G F+F N +
Sbjct: 146 EWIYPNGTVYRGPFQHNKPNGVGRFEFPNKNQV 178



Score = 57.8 bits (138), Expect = 4e-07
Identities = 30/86 (34%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGA-TFNGEYADNLRNGRGTLSYPNKSS 375
HG+G+ TY+N D + G + GKK G G Y F + A F G + +N G YPN +
Sbjct: 96 HGEGLYTYANKDVYSGQWSRGKKHGQGTYVFNDTAMRFRGTWNNN-EIVDGEWIYPNGTV 154

Query: 374 YEGSWKRGKKDGIGSYTYANGDLYKG 297
Y G ++ K +G+G + + N + +G
Sbjct: 155 YRGPFQHNKPNGVGRFEFPNKNQVEG 180


>tr|A7SRL1|A7SRL1_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g128910 PE=4 SV=1
Length = 200

Score = 147 bits (371), Expect = 4e-34
Identities = 65/147 (44%), Positives = 98/147 (66%), Gaps = 1/147 (0%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HGQG A NGD++EG+Y+ GK+ G G+Y+F NGA + G Y DN +NG G YP+ S Y
Sbjct: 30 HGQGRAKLPNGDTYEGSYENGKRHGKGIYRFKNGARYIGHYLDNKKNGEGLFYYPDGSKY 89

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNF-ANG 195
EG W ++ G G+YTYAN D+++GEW+ +KRHG+GTY + ++ S+F G W G +G
Sbjct: 90 EGYWVNDQRHGYGTYTYANKDIFEGEWVQNKRHGQGTYTYAETGSRFEGTWFQGRMQGSG 149

Query: 194 EWIHRDGNIYEGVFALNKPQGPGSFKF 114
+ +H + + + G F + P+G G ++F
Sbjct: 150 QLVHAN-HRFVGSFTDDHPKGRGRYEF 175



Score = 61.2 bits (147), Expect = 4e-08
Identities = 38/110 (34%), Positives = 63/110 (57%), Gaps = 3/110 (2%)
Frame = -1

Query: 389 PNKSSYEGSW-KRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWAL 213
P+ YEG +R ++ G G NGD Y+G + + KRHGKG Y FK+ +++ G + L
Sbjct: 14 PDLGEYEGERNEREERHGQGRAKLPNGDTYEGSYENGKRHGKGIYRFKNG-ARYIGHY-L 71

Query: 212 GNFANGE--WIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVDQK 69
N NGE + + DG+ YEG + ++ G G++ + + ++ GE+V K
Sbjct: 72 DNKKNGEGLFYYPDGSKYEGYWVNDQRHGYGTYT-YANKDIFEGEWVQNK 120


>tr|Q3YEA6|Q3YEA6_MOUSE TSGA2 OS=Mus musculus GN=Rsph1 PE=2 SV=1
Length = 301

Score = 144 bits (364), Expect = 3e-33
Identities = 66/157 (42%), Positives = 91/157 (57%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G A SNGD++EG+Y+ GK+ G G YKF NGA + G+Y N ++G+GT YP+ S Y
Sbjct: 31 HGHGKARLSNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRY 90

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFANGE 192
EG W ++ G G Y Y N D Y GEW + +RHG+GTY + ++ S++ G W G
Sbjct: 91 EGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAA 150

Query: 191 WIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEY 81
+ + Y+G F P GPG + F HGEY
Sbjct: 151 ELIHLNHRYQGKFMNKNPVGPGKY-VFDIGCEQHGEY 186



Score = 67.8 bits (164), Expect = 4e-10
Identities = 34/114 (29%), Positives = 64/114 (56%), Gaps = 1/114 (0%)
Frame = -1

Query: 416 RNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMS 237
R+G G N +YEGS++ GK+ G G+Y + NG Y G+++ +K+HG+GT+ + D S
Sbjct: 30 RHGHGKARLSNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDG-S 88

Query: 236 QFCGAWALG-NFANGEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYV 78
++ G WA G + + + + Y G + ++ G G++ + + + G +V
Sbjct: 89 RYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWV 142



Score = 57.8 bits (138), Expect = 4e-07
Identities = 36/112 (32%), Positives = 63/112 (56%), Gaps = 3/112 (2%)
Frame = -1

Query: 374 YEGSWKR-GKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG-NFA 201
YEG G++ G G +NGD Y+G + KRHG+GTY FK+ +++ G +
Sbjct: 20 YEGERNEVGERHGHGKARLSNGDTYEGSYEFGKRHGQGTYKFKNG-ARYTGDYVKNKKHG 78

Query: 200 NGEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVD-QKWSSGQFV 48
G +I+ DG+ YEG +A ++ G G + ++ +N+ GE+ + Q+ G ++
Sbjct: 79 QGTFIYPDGSRYEGEWADDQRHGQGVY-YYVNNDTYTGEWFNHQRHGQGTYL 129


>tr|Q3YEA4|Q3YEA4_MOUSE TSGA2 OS=Mus musculus GN=Rsph1 PE=2 SV=1
Length = 301

Score = 142 bits (359), Expect = 1e-32
Identities = 65/157 (41%), Positives = 90/157 (57%)
Frame = -1

Query: 551 HGQGVATYSNGDSFEGAYDMGKKQGPGLYKFANGATFNGEYADNLRNGRGTLSYPNKSSY 372
HG G A NGD++EG+Y+ GK+ G G YKF NGA + G+Y N ++G+GT YP+ S Y
Sbjct: 31 HGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDGSRY 90

Query: 371 EGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALGNFANGE 192
EG W ++ G G Y Y N D Y GEW + +RHG+GTY + ++ S++ G W G
Sbjct: 91 EGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWVHGQQEGAA 150

Query: 191 WIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEY 81
+ + Y+G F P GPG + F HGEY
Sbjct: 151 ELIHLNHRYQGKFMNKNPVGPGKY-VFDIGCEQHGEY 186



Score = 70.9 bits (172), Expect = 5e-11
Identities = 35/114 (30%), Positives = 65/114 (57%), Gaps = 1/114 (0%)
Frame = -1

Query: 416 RNGRGTLSYPNKSSYEGSWKRGKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMS 237
R+G G PN +YEGS++ GK+ G G+Y + NG Y G+++ +K+HG+GT+ + D S
Sbjct: 30 RHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNGARYTGDYVKNKKHGQGTFIYPDG-S 88

Query: 236 QFCGAWALG-NFANGEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYV 78
++ G WA G + + + + Y G + ++ G G++ + + + G +V
Sbjct: 89 RYEGEWADDQRHGQGVYYYVNNDTYTGEWFNHQRHGQGTYLYAETGSKYVGTWV 142



Score = 57.0 bits (136), Expect = 7e-07
Identities = 36/112 (32%), Positives = 62/112 (55%), Gaps = 3/112 (2%)
Frame = -1

Query: 374 YEGSWKR-GKKDGIGSYTYANGDLYKGEWLDDKRHGKGTYYFKDSMSQFCGAWALG-NFA 201
YEG G++ G G NGD Y+G + KRHG+GTY FK+ +++ G +
Sbjct: 20 YEGERNEVGERHGHGKARLPNGDTYEGSYEFGKRHGQGTYKFKNG-ARYTGDYVKNKKHG 78

Query: 200 NGEWIHRDGNIYEGVFALNKPQGPGSFKFFRSNNLLHGEYVD-QKWSSGQFV 48
G +I+ DG+ YEG +A ++ G G + ++ +N+ GE+ + Q+ G ++
Sbjct: 79 QGTFIYPDGSRYEGEWADDQRHGQGVY-YYVNNDTYTGEWFNHQRHGQGTYL 129