BP912856
Clone id YMU001_000023_F06
Library
Length 571
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000023_F06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATAAATGGAAGGTGCACATCACACATACATACACATTGATGTAGGAGGCACATGGAATT
CAGACACTATAAAATTGGCTTTCCTACTCCTAGTCTCTGTGAAGGTATTACAAAGAAACA
AACCCATAATAGAATTCAAGCAATTCAATAGGAAAGGGCATAAAACCTAACGCATATGGA
CAGCATACTTGTCCAGTGTCCTCTAGTAACAAAGCCTGACGTAAGGACTCTAAAAGTAGT
GCATGTGGGTGGCATGTCATGTGTGCTTCATTCAACCAAAGCATATGGTGTGCTTCCATT
CAAGCAAACATACCATGAGAAGCTTCTAATAACACCTTGGAAAAGTAAGCTCATGCAAGA
GCATAGTATAATACAAACACTTTGACAAAAGCATGCGGCAAAAGTAAAACATAATAGTAA
ATGCAAAAATTAAAACACTCTCTGTCTTTATCTCCGCCCCTTAAATGGATGTAGTAACAA
GTAAGGAAAATTGCCTATTGTTCCTATCTCANAATATACCATCATGGAACACTTCGTAAC
AATGGGTCAACAAGGCCACAATCAGATTGAA
■■Homology search results ■■ -
sp_hit_id Q9VNG1
Definition sp|Q9VNG1|GGNB2_DROME Gametogenetin-binding protein 2-like OS=Drosophila melanogaster
Align length 40
Score (bit) 30.0
E-value 8.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912856|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_F06.
(571 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9VNG1|GGNB2_DROME Gametogenetin-binding protein 2-like OS=Dr... 30 8.5

>sp|Q9VNG1|GGNB2_DROME Gametogenetin-binding protein 2-like
OS=Drosophila melanogaster GN=CG2182 PE=2 SV=3
Length = 671

Score = 30.0 bits (66), Expect = 8.5
Identities = 16/40 (40%), Positives = 23/40 (57%)
Frame = +2

Query: 260 CVLHSTKAYGVLPFKQTYHEKLLITPWKSKLMQEHSIIQT 379
CVLHS A+ PF +T+ E + + KS E +II+T
Sbjct: 161 CVLHSLDAFRAKPFSETWRE--VWSAMKSNCRNELTIIET 198


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912856|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_F06.
(571 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******