BP912873
Clone id YMU001_000023_G12
Library
Length 536
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000023_G12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATCCCTTGGAGATGGAGATCGATAACGTGGAGATCGCTGAGGTGAATATCCACGATATG
GAGATCTCCTGCCACCACCATAACCCATCCGACCCCTTCCTCTTTCTTTTACCCGCATTT
CTTCTGGCCTCTTTCTATTCTCTTCTGCAAATACAACAGTGAGTTTCGCGTCCCCCCAAA
ATCTGGCGATCCATGTATCTTCTTGCTTCAGCAGCATCAAGAGGATCCAAGTATTGCACA
AATCCAAAACCTCGTGGCTCCCCAGTGTAGTAATCTCTTGGCAGATACACATCGCGAACC
CGCCCAAAACGCTCAAAAGGTATCCTCAGATCTTCAGGTCTGCTGCCTTTGGAGATGTTG
CGCACTAAAAGACCACACGGAGCATCTCTGTGTCCTCCAAATCGACCGCGAGGAGGACTC
CTCCCTCGGCCTCCGTAGCCCCTTCTGGGAGGGCTATAGCTAGGACTCCGTCGCCTCATT
CTTTTTACAGTAGGTTATGGCCAAATAACACTTTCGCACCAGGCGCTGCGAGAGGG
■■Homology search results ■■ -
sp_hit_id Q8WXF0
Definition sp|Q8WXF0|SRR35_HUMAN 35 kDa SR repressor protein OS=Homo sapiens
Align length 69
Score (bit) 71.2
E-value 3.0e-12
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912873|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_G12.
(536 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8WXF0|SRR35_HUMAN 35 kDa SR repressor protein OS=Homo sapien... 71 3e-12
sp|Q9R0U0|FUSIP_MOUSE FUS-interacting serine-arginine-rich prote... 71 4e-12
sp|O75494|FUSIP_HUMAN FUS-interacting serine-arginine-rich prote... 71 4e-12
sp|Q6PDU1|SFRS2_RAT Splicing factor, arginine/serine-rich 2 OS=R... 70 6e-12
sp|Q06A98|SFRS2_PIG Splicing factor, arginine/serine-rich 2 OS=S... 70 6e-12
sp|Q5R1W5|SFRS2_PANTR Splicing factor, arginine/serine-rich 2 OS... 70 6e-12
sp|Q62093|SFRS2_MOUSE Splicing factor, arginine/serine-rich 2 OS... 70 6e-12
sp|Q01130|SFRS2_HUMAN Splicing factor, arginine/serine-rich 2 OS... 70 6e-12
sp|P30352|SFRS2_CHICK Splicing factor, arginine/serine-rich 2 OS... 70 6e-12
sp|Q3MHR5|SFRS2_BOVIN Splicing factor, arginine/serine-rich 2 OS... 70 6e-12
sp|Q9BRL6|SFR2B_HUMAN Splicing factor, arginine/serine-rich 2B O... 66 1e-10
sp|Q09511|RSP4_CAEEL Probable splicing factor, arginine/serine-r... 63 8e-10
sp|Q2H0U6|EIF3G_CHAGB Eukaryotic translation initiation factor 3... 58 3e-08
sp|Q54PB2|MRD1_DICDI Multiple RNA-binding domain-containing prot... 58 3e-08
sp|Q5AJS6|MRD1_CANAL Multiple RNA-binding domain-containing prot... 58 3e-08
sp|Q0U6E7|EIF3G_PHANO Eukaryotic translation initiation factor 3... 57 4e-08
sp|Q6MFP4|EIF3G_NEUCR Eukaryotic translation initiation factor 3... 57 7e-08
sp|A4RHN3|EIF3G_MAGGR Eukaryotic translation initiation factor 3... 57 7e-08
sp|P78795|EIF3G_SCHPO Eukaryotic translation initiation factor 3... 56 1e-07
sp|A1DGS2|EIF3G_NEOFI Eukaryotic translation initiation factor 3... 53 8e-07
sp|Q4X1I3|EIF3G_ASPFU Eukaryotic translation initiation factor 3... 53 8e-07
sp|B0XS28|EIF3G_ASPFC Eukaryotic translation initiation factor 3... 53 8e-07
sp|Q8R3C6|RBM19_MOUSE Probable RNA-binding protein 19 OS=Mus mus... 53 1e-06
sp|Q5B0B3|EIF3G_EMENI Eukaryotic translation initiation factor 3... 53 1e-06
sp|Q06106|MRD1_YEAST Multiple RNA-binding domain-containing prot... 52 2e-06
sp|Q2U002|EIF3G_ASPOR Eukaryotic translation initiation factor 3... 52 2e-06
sp|A2R7Z2|EIF3G_ASPNC Eukaryotic translation initiation factor 3... 52 2e-06
sp|A1C646|EIF3G_ASPCL Eukaryotic translation initiation factor 3... 52 2e-06
sp|P70318|TIAR_MOUSE Nucleolysin TIAR OS=Mus musculus GN=Tial1 P... 52 2e-06
sp|Q01085|TIAR_HUMAN Nucleolysin TIAR OS=Homo sapiens GN=TIAL1 P... 52 2e-06

>sp|Q8WXF0|SRR35_HUMAN 35 kDa SR repressor protein OS=Homo sapiens
GN=SRRP35 PE=1 SV=1
Length = 261

Score = 71.2 bits (173), Expect = 3e-12
Identities = 32/69 (46%), Positives = 48/69 (69%)
Frame = -1

Query: 371 LLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPLDAAEARRYM 192
L +RN++ +RPEDLR F R+G + DVY+P D+YT PRGF +VQ+ D DA +A +
Sbjct: 12 LFIRNVADATRPEDLRREFGRYGPIVDVYIPLDFYTRRPRGFAYVQFEDVRDAEDALYNL 71

Query: 191 DRQILGGRE 165
+R+ + GR+
Sbjct: 72 NRKWVCGRQ 80


>sp|Q9R0U0|FUSIP_MOUSE FUS-interacting serine-arginine-rich protein
1 OS=Mus musculus GN=Fusip1 PE=1 SV=2
Length = 262

Score = 70.9 bits (172), Expect = 4e-12
Identities = 33/69 (47%), Positives = 47/69 (68%)
Frame = -1

Query: 371 LLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPLDAAEARRYM 192
L VRN++ +R EDLR F R+G + DVY+P D+YT PRGF +VQ+ D DA +A +
Sbjct: 12 LFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNL 71

Query: 191 DRQILGGRE 165
DR+ + GR+
Sbjct: 72 DRKWICGRQ 80


>sp|O75494|FUSIP_HUMAN FUS-interacting serine-arginine-rich protein
1 OS=Homo sapiens GN=FUSIP1 PE=1 SV=1
Length = 262

Score = 70.9 bits (172), Expect = 4e-12
Identities = 33/69 (47%), Positives = 47/69 (68%)
Frame = -1

Query: 371 LLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPLDAAEARRYM 192
L VRN++ +R EDLR F R+G + DVY+P D+YT PRGF +VQ+ D DA +A +
Sbjct: 12 LFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNL 71

Query: 191 DRQILGGRE 165
DR+ + GR+
Sbjct: 72 DRKWICGRQ 80


>sp|Q6PDU1|SFRS2_RAT Splicing factor, arginine/serine-rich 2
OS=Rattus norvegicus GN=Sfrs2 PE=1 SV=3
Length = 221

Score = 70.1 bits (170), Expect = 6e-12
Identities = 35/69 (50%), Positives = 46/69 (66%)
Frame = -1

Query: 371 LLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPLDAAEARRYM 192
L V N++ + P+ LR FE++GRV DVY+PRD YT E RGF FV++ D DA +A M
Sbjct: 16 LKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAM 75

Query: 191 DRQILGGRE 165
D +L GRE
Sbjct: 76 DGAVLDGRE 84


>sp|Q06A98|SFRS2_PIG Splicing factor, arginine/serine-rich 2 OS=Sus
scrofa GN=SFRS2 PE=2 SV=1
Length = 221

Score = 70.1 bits (170), Expect = 6e-12
Identities = 35/69 (50%), Positives = 46/69 (66%)
Frame = -1

Query: 371 LLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPLDAAEARRYM 192
L V N++ + P+ LR FE++GRV DVY+PRD YT E RGF FV++ D DA +A M
Sbjct: 16 LKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAM 75

Query: 191 DRQILGGRE 165
D +L GRE
Sbjct: 76 DGAVLDGRE 84


>sp|Q5R1W5|SFRS2_PANTR Splicing factor, arginine/serine-rich 2
OS=Pan troglodytes GN=SFRS2 PE=2 SV=3
Length = 221

Score = 70.1 bits (170), Expect = 6e-12
Identities = 35/69 (50%), Positives = 46/69 (66%)
Frame = -1

Query: 371 LLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPLDAAEARRYM 192
L V N++ + P+ LR FE++GRV DVY+PRD YT E RGF FV++ D DA +A M
Sbjct: 16 LKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAM 75

Query: 191 DRQILGGRE 165
D +L GRE
Sbjct: 76 DGAVLDGRE 84


>sp|Q62093|SFRS2_MOUSE Splicing factor, arginine/serine-rich 2
OS=Mus musculus GN=Sfrs2 PE=1 SV=4
Length = 221

Score = 70.1 bits (170), Expect = 6e-12
Identities = 35/69 (50%), Positives = 46/69 (66%)
Frame = -1

Query: 371 LLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPLDAAEARRYM 192
L V N++ + P+ LR FE++GRV DVY+PRD YT E RGF FV++ D DA +A M
Sbjct: 16 LKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAM 75

Query: 191 DRQILGGRE 165
D +L GRE
Sbjct: 76 DGAVLDGRE 84


>sp|Q01130|SFRS2_HUMAN Splicing factor, arginine/serine-rich 2
OS=Homo sapiens GN=SFRS2 PE=1 SV=4
Length = 221

Score = 70.1 bits (170), Expect = 6e-12
Identities = 35/69 (50%), Positives = 46/69 (66%)
Frame = -1

Query: 371 LLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPLDAAEARRYM 192
L V N++ + P+ LR FE++GRV DVY+PRD YT E RGF FV++ D DA +A M
Sbjct: 16 LKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAM 75

Query: 191 DRQILGGRE 165
D +L GRE
Sbjct: 76 DGAVLDGRE 84


>sp|P30352|SFRS2_CHICK Splicing factor, arginine/serine-rich 2
OS=Gallus gallus GN=SFRS2 PE=2 SV=1
Length = 221

Score = 70.1 bits (170), Expect = 6e-12
Identities = 35/69 (50%), Positives = 46/69 (66%)
Frame = -1

Query: 371 LLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPLDAAEARRYM 192
L V N++ + P+ LR FE++GRV DVY+PRD YT E RGF FV++ D DA +A M
Sbjct: 16 LKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAM 75

Query: 191 DRQILGGRE 165
D +L GRE
Sbjct: 76 DGAVLDGRE 84


>sp|Q3MHR5|SFRS2_BOVIN Splicing factor, arginine/serine-rich 2
OS=Bos taurus GN=SFRS2 PE=2 SV=3
Length = 221

Score = 70.1 bits (170), Expect = 6e-12
Identities = 35/69 (50%), Positives = 46/69 (66%)
Frame = -1

Query: 371 LLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPLDAAEARRYM 192
L V N++ + P+ LR FE++GRV DVY+PRD YT E RGF FV++ D DA +A M
Sbjct: 16 LKVDNLTYRTSPDTLRRVFEKYGRVGDVYIPRDRYTKESRGFAFVRFHDKRDAEDAMDAM 75

Query: 191 DRQILGGRE 165
D +L GRE
Sbjct: 76 DGAVLDGRE 84


tr_hit_id Q0DRL1
Definition tr|Q0DRL1|Q0DRL1_ORYSJ Os03g0374500 protein OS=Oryza sativa subsp. japonica
Align length 78
Score (bit) 115.0
E-value 2.0e-29
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912873|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_G12.
(536 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q0DRL1|Q0DRL1_ORYSJ Os03g0374500 protein OS=Oryza sativa subs... 115 2e-29
tr|Q7Y171|Q7Y171_ORYSJ Putative splicing factor (RNA recognition... 115 2e-29
tr|Q10KQ7|Q10KQ7_ORYSJ RNA recognition motif family protein, exp... 115 2e-29
tr|B8AQ95|B8AQ95_ORYSI Putative uncharacterized protein OS=Oryza... 115 2e-29
tr|B6U7F9|B6U7F9_MAIZE Splicing factor, arginine/serine-rich 4 O... 115 2e-29
tr|B6THS7|B6THS7_MAIZE Splicing factor, arginine/serine-rich 4 O... 115 2e-29
tr|B4F8E1|B4F8E1_MAIZE Putative uncharacterized protein OS=Zea m... 115 2e-29
tr|A3AIF5|A3AIF5_ORYSJ Putative uncharacterized protein OS=Oryza... 115 2e-29
tr|B4FH97|B4FH97_MAIZE Putative uncharacterized protein OS=Zea m... 115 2e-29
tr|A9NPS4|A9NPS4_PICSI Putative uncharacterized protein OS=Picea... 113 3e-28
tr|Q9LHP2|Q9LHP2_ARATH Similarity to Serine/arginine-rich protei... 110 1e-27
tr|Q9FYA8|Q9FYA8_ARATH SC35-like splicing factor SCL30a, 30a kD ... 110 1e-27
tr|A9T8E3|A9T8E3_PHYPA Predicted protein OS=Physcomitrella paten... 107 1e-27
tr|A9TN63|A9TN63_PHYPA Predicted protein (Fragment) OS=Physcomit... 106 1e-27
tr|A3BMI8|A3BMI8_ORYSJ Putative uncharacterized protein OS=Oryza... 114 1e-27
tr|B8B4Y2|B8B4Y2_ORYSI Putative uncharacterized protein OS=Oryza... 114 1e-27
tr|Q7XI49|Q7XI49_ORYSJ Os07g0633200 protein OS=Oryza sativa subs... 114 1e-27
tr|A9P1I2|A9P1I2_PICSI Putative uncharacterized protein OS=Picea... 110 5e-27
tr|Q9SEU4|Q9SEU4_ARATH At1g55310 OS=Arabidopsis thaliana GN=scl3... 106 8e-27
tr|Q949P4|Q949P4_ARATH Putative uncharacterized protein At1g5531... 106 8e-27
tr|Q9C8A1|Q9C8A1_ARATH Putative uncharacterized protein F7A10.15... 106 8e-27
tr|A3A546|A3A546_ORYSJ Putative uncharacterized protein OS=Oryza... 109 8e-26
tr|B8AFC0|B8AFC0_ORYSI Putative uncharacterized protein OS=Oryza... 109 8e-26
tr|Q9FR79|Q9FR79_ORYSA Pre-mRNA splicing factor OS=Oryza sativa ... 109 8e-26
tr|Q6K542|Q6K542_ORYSJ Os02g0252100 protein OS=Oryza sativa subs... 109 8e-26
tr|Q2QNB0|Q2QNB0_ORYSJ Os12g0572400 protein OS=Oryza sativa subs... 108 2e-25
tr|B8BML9|B8BML9_ORYSI Putative uncharacterized protein OS=Oryza... 108 2e-25
tr|A3CIN1|A3CIN1_ORYSJ Putative uncharacterized protein OS=Oryza... 108 2e-25
tr|B6TMB4|B6TMB4_MAIZE SR repressor protein OS=Zea mays PE=2 SV=1 108 5e-25
tr|B4FND7|B4FND7_MAIZE Putative uncharacterized protein OS=Zea m... 108 5e-25

>tr|Q0DRL1|Q0DRL1_ORYSJ Os03g0374500 protein OS=Oryza sativa subsp.
japonica GN=Os03g0374500 PE=4 SV=1
Length = 814

Score = 115 bits (289), Expect(2) = 2e-29
Identities = 53/78 (67%), Positives = 63/78 (80%)
Frame = -1

Query: 398 GGHRDAPCGLLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPL 219
G RD P LLVRN+ + RP+DLR PF +FGRV+D+YLPRDYYTGEPRGFGF+QY DP
Sbjct: 30 GRDRDLPTSLLVRNLRRDCRPDDLRRPFGKFGRVKDIYLPRDYYTGEPRGFGFIQYYDPE 89

Query: 218 DAAEARRYMDRQILGGRE 165
DAA+A+ +MD QIL GRE
Sbjct: 90 DAADAKYHMDGQILLGRE 107



Score = 36.2 bits (82), Expect(2) = 2e-29
Identities = 15/21 (71%), Positives = 19/21 (90%)
Frame = -2

Query: 166 KLTVVFAEENRKRPEEMRVKE 104
++TVVFAEENRK+P EMR +E
Sbjct: 107 EVTVVFAEENRKKPSEMRARE 127


>tr|Q7Y171|Q7Y171_ORYSJ Putative splicing factor (RNA recognition
motif family protein, expressed) OS=Oryza sativa subsp.
japonica GN=OSJNBa0090L05.13 PE=4 SV=1
Length = 217

Score = 115 bits (289), Expect(2) = 2e-29
Identities = 53/78 (67%), Positives = 63/78 (80%)
Frame = -1

Query: 398 GGHRDAPCGLLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPL 219
G RD P LLVRN+ + RP+DLR PF +FGRV+D+YLPRDYYTGEPRGFGF+QY DP
Sbjct: 30 GRDRDLPTSLLVRNLRRDCRPDDLRRPFGKFGRVKDIYLPRDYYTGEPRGFGFIQYYDPE 89

Query: 218 DAAEARRYMDRQILGGRE 165
DAA+A+ +MD QIL GRE
Sbjct: 90 DAADAKYHMDGQILLGRE 107



Score = 36.2 bits (82), Expect(2) = 2e-29
Identities = 15/21 (71%), Positives = 19/21 (90%)
Frame = -2

Query: 166 KLTVVFAEENRKRPEEMRVKE 104
++TVVFAEENRK+P EMR +E
Sbjct: 107 EVTVVFAEENRKKPSEMRARE 127


>tr|Q10KQ7|Q10KQ7_ORYSJ RNA recognition motif family protein,
expressed OS=Oryza sativa subsp. japonica
GN=LOC_Os03g25770 PE=4 SV=1
Length = 218

Score = 115 bits (289), Expect(2) = 2e-29
Identities = 53/78 (67%), Positives = 63/78 (80%)
Frame = -1

Query: 398 GGHRDAPCGLLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPL 219
G RD P LLVRN+ + RP+DLR PF +FGRV+D+YLPRDYYTGEPRGFGF+QY DP
Sbjct: 30 GRDRDLPTSLLVRNLRRDCRPDDLRRPFGKFGRVKDIYLPRDYYTGEPRGFGFIQYYDPE 89

Query: 218 DAAEARRYMDRQILGGRE 165
DAA+A+ +MD QIL GRE
Sbjct: 90 DAADAKYHMDGQILLGRE 107



Score = 36.2 bits (82), Expect(2) = 2e-29
Identities = 15/21 (71%), Positives = 19/21 (90%)
Frame = -2

Query: 166 KLTVVFAEENRKRPEEMRVKE 104
++TVVFAEENRK+P EMR +E
Sbjct: 107 EVTVVFAEENRKKPSEMRARE 127


>tr|B8AQ95|B8AQ95_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_11773 PE=4 SV=1
Length = 217

Score = 115 bits (289), Expect(2) = 2e-29
Identities = 53/78 (67%), Positives = 63/78 (80%)
Frame = -1

Query: 398 GGHRDAPCGLLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPL 219
G RD P LLVRN+ + RP+DLR PF +FGRV+D+YLPRDYYTGEPRGFGF+QY DP
Sbjct: 30 GRDRDLPTSLLVRNLRRDCRPDDLRRPFGKFGRVKDIYLPRDYYTGEPRGFGFIQYYDPE 89

Query: 218 DAAEARRYMDRQILGGRE 165
DAA+A+ +MD QIL GRE
Sbjct: 90 DAADAKYHMDGQILLGRE 107



Score = 36.2 bits (82), Expect(2) = 2e-29
Identities = 15/21 (71%), Positives = 19/21 (90%)
Frame = -2

Query: 166 KLTVVFAEENRKRPEEMRVKE 104
++TVVFAEENRK+P EMR +E
Sbjct: 107 EVTVVFAEENRKKPSEMRARE 127


>tr|B6U7F9|B6U7F9_MAIZE Splicing factor, arginine/serine-rich 4
OS=Zea mays PE=2 SV=1
Length = 209

Score = 115 bits (289), Expect(2) = 2e-29
Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
Frame = -1

Query: 401 FGGH-RDAPCGLLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLD 225
+GG RD P LLVRN+ + RPEDLR PF +FGRV+D+YLPRDYYTG+PRGFGFVQY D
Sbjct: 28 YGGRGRDLPTSLLVRNLRRDCRPEDLRRPFGQFGRVKDIYLPRDYYTGDPRGFGFVQYYD 87

Query: 224 PLDAAEARRYMDRQILGGRE 165
P DAA+A+ YMD Q++ GR+
Sbjct: 88 PADAADAKYYMDGQVVLGRQ 107



Score = 36.2 bits (82), Expect(2) = 2e-29
Identities = 14/21 (66%), Positives = 20/21 (95%)
Frame = -2

Query: 166 KLTVVFAEENRKRPEEMRVKE 104
++TVVFAEENRK+P+EMR ++
Sbjct: 107 QITVVFAEENRKKPQEMRARD 127


>tr|B6THS7|B6THS7_MAIZE Splicing factor, arginine/serine-rich 4
OS=Zea mays PE=2 SV=1
Length = 209

Score = 115 bits (289), Expect(2) = 2e-29
Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
Frame = -1

Query: 401 FGGH-RDAPCGLLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLD 225
+GG RD P LLVRN+ + RPEDLR PF +FGRV+D+YLPRDYYTG+PRGFGFVQY D
Sbjct: 28 YGGRGRDLPTSLLVRNLRRDCRPEDLRRPFGQFGRVKDIYLPRDYYTGDPRGFGFVQYYD 87

Query: 224 PLDAAEARRYMDRQILGGRE 165
P DAA+A+ YMD Q++ GR+
Sbjct: 88 PADAADAKYYMDGQVVLGRQ 107



Score = 36.2 bits (82), Expect(2) = 2e-29
Identities = 14/21 (66%), Positives = 20/21 (95%)
Frame = -2

Query: 166 KLTVVFAEENRKRPEEMRVKE 104
++TVVFAEENRK+P+EMR ++
Sbjct: 107 QITVVFAEENRKKPQEMRARD 127


>tr|B4F8E1|B4F8E1_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 209

Score = 115 bits (289), Expect(2) = 2e-29
Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
Frame = -1

Query: 401 FGGH-RDAPCGLLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLD 225
+GG RD P LLVRN+ + RPEDLR PF +FGRV+D+YLPRDYYTG+PRGFGFVQY D
Sbjct: 28 YGGRGRDLPTSLLVRNLRRDCRPEDLRRPFGQFGRVKDIYLPRDYYTGDPRGFGFVQYYD 87

Query: 224 PLDAAEARRYMDRQILGGRE 165
P DAA+A+ YMD Q++ GR+
Sbjct: 88 PADAADAKYYMDGQVVLGRQ 107



Score = 36.2 bits (82), Expect(2) = 2e-29
Identities = 14/21 (66%), Positives = 20/21 (95%)
Frame = -2

Query: 166 KLTVVFAEENRKRPEEMRVKE 104
++TVVFAEENRK+P+EMR ++
Sbjct: 107 QITVVFAEENRKKPQEMRARD 127


>tr|A3AIF5|A3AIF5_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_010577 PE=4 SV=1
Length = 202

Score = 115 bits (289), Expect(2) = 2e-29
Identities = 53/78 (67%), Positives = 63/78 (80%)
Frame = -1

Query: 398 GGHRDAPCGLLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDPL 219
G RD P LLVRN+ + RP+DLR PF +FGRV+D+YLPRDYYTGEPRGFGF+QY DP
Sbjct: 30 GRDRDLPTSLLVRNLRRDCRPDDLRRPFGKFGRVKDIYLPRDYYTGEPRGFGFIQYYDPE 89

Query: 218 DAAEARRYMDRQILGGRE 165
DAA+A+ +MD QIL GRE
Sbjct: 90 DAADAKYHMDGQILLGRE 107



Score = 36.2 bits (82), Expect(2) = 2e-29
Identities = 15/21 (71%), Positives = 19/21 (90%)
Frame = -2

Query: 166 KLTVVFAEENRKRPEEMRVKE 104
++TVVFAEENRK+P EMR +E
Sbjct: 107 EVTVVFAEENRKKPSEMRARE 127


>tr|B4FH97|B4FH97_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 134

Score = 115 bits (289), Expect(2) = 2e-29
Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 1/80 (1%)
Frame = -1

Query: 401 FGGH-RDAPCGLLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLD 225
+GG RD P LLVRN+ + RPEDLR PF +FGRV+D+YLPRDYYTG+PRGFGFVQY D
Sbjct: 28 YGGRGRDLPTSLLVRNLRRDCRPEDLRRPFGQFGRVKDIYLPRDYYTGDPRGFGFVQYYD 87

Query: 224 PLDAAEARRYMDRQILGGRE 165
P DAA+A+ YMD Q++ GR+
Sbjct: 88 PADAADAKYYMDGQVVLGRQ 107



Score = 36.2 bits (82), Expect(2) = 2e-29
Identities = 14/21 (66%), Positives = 20/21 (95%)
Frame = -2

Query: 166 KLTVVFAEENRKRPEEMRVKE 104
++TVVFAEENRK+P+EMR ++
Sbjct: 107 QITVVFAEENRKKPQEMRARD 127


>tr|A9NPS4|A9NPS4_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 275

Score = 113 bits (282), Expect(2) = 3e-28
Identities = 50/79 (63%), Positives = 65/79 (82%)
Frame = -1

Query: 401 FGGHRDAPCGLLVRNISKGSRPEDLRIPFERFGRVRDVYLPRDYYTGEPRGFGFVQYLDP 222
+GG R+ LLVRNI + R ++LR+PFERFG ++DVYLP+D+YTGEPRGFGFVQ++DP
Sbjct: 28 YGGRREPNTSLLVRNIPRDCRSDELRMPFERFGPLKDVYLPKDFYTGEPRGFGFVQFMDP 87

Query: 221 LDAAEARRYMDRQILGGRE 165
DAAEA+ +MD Q +GGRE
Sbjct: 88 QDAAEAQYHMDGQYIGGRE 106



Score = 35.0 bits (79), Expect(2) = 3e-28
Identities = 14/26 (53%), Positives = 22/26 (84%)
Frame = -2

Query: 184 RFWGDAKLTVVFAEENRKRPEEMRVK 107
++ G ++TVV AE+NRK+P+EMRV+
Sbjct: 100 QYIGGREITVVLAEKNRKKPDEMRVR 125