BP912874
Clone id YMU001_000023_H01
Library
Length 527
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000023_H01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGCTGAAGGGAGAGAGGAGTGAGAACTTCCTCTTGACAAGAGTCCAATGCTATCAAATTG
GAGGTTTTTTTTTTTTCATTTTGGTGACAGCCTGTGGAGGTAAATCACTGGCATCGGCGA
GGCCTCCGGAGCTGCATGAGTGAGTGACAAAGTGCGTGTATGTGTGTGAGCCATGTAGCA
CAGGCGAGGAGTCGAGGGTGTGTGCGTGTGTGTGTCTTGACGGAGCCAGCGTCGGCAGCG
AGCAAGGCCGGGTGGGGCATGCACGTGCTGGGCTAGCGTGTTATTCCAAGCAAGTGGTGT
GTGTGACCGGAAAGACCGGTGGCTTTTGTGCAGCGCAGACCACATGTTGCATCCTGTTAT
AGAGTGTGTGTGTGTGTGTGTGAGTTGGAAGCAAGTGCCGAGCATGGATTGCGCATTTAT
GGCAGGTGTGTGTGTGTATGCAATGTGCCAAAATCGGCAAGTGGCATCGAGAGTGTGTGT
GTGTTGCTGATGCGCCAAGCCAAGCCAAGTTGATCCAAAAGTGGAGG
■■Homology search results ■■ -
sp_hit_id Q6ZRP5
Definition sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ46204 OS=Homo sapiens
Align length 118
Score (bit) 43.5
E-value 0.0006
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912874|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_H01.
(527 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ46204 ... 44 6e-04
sp|Q99MH6|NKD1_MOUSE Protein naked cuticle homolog 1 OS=Mus musc... 37 0.058
sp|Q502M8|EXOD1_DANRE Exonuclease domain-containing protein 1 OS... 27 0.57
sp|Q6NTV1|RNFT1_XENLA RING finger and transmembrane domain-conta... 28 0.58
sp|Q8JGR7|INT7_DANRE Integrator complex subunit 7 OS=Danio rerio... 32 1.9
sp|O13588|YA069_YEAST Putative uncharacterized protein YAL069W O... 32 2.4
sp|P06333|TCB1_RABIT T-cell receptor beta chain ANA 11 OS=Orycto... 32 2.4
sp|Q3TDN0|DISP1_MOUSE Protein dispatched homolog 1 OS=Mus muscul... 32 2.4
sp|Q80YX1|TENA_MOUSE Tenascin OS=Mus musculus GN=Tnc PE=1 SV=1 31 3.2
sp|Q7TQM3|FGRL1_RAT Fibroblast growth factor receptor-like 1 OS=... 31 3.2
sp|Q91V87|FGRL1_MOUSE Fibroblast growth factor receptor-like 1 O... 31 3.2
sp|Q4PBP6|NST1_USTMA Stress response protein NST1 OS=Ustilago ma... 26 5.2
sp|O95428|PPN_HUMAN Papilin OS=Homo sapiens GN=PAPLN PE=2 SV=3 30 5.4
sp|Q9I8A3|HEY1_XENLA Hairy/enhancer-of-split related with YRPW m... 30 5.4
sp|Q99LH4|ZN672_MOUSE Zinc finger protein 672 OS=Mus musculus GN... 30 7.1
sp|Q96N35|TMM83_HUMAN Transmembrane protein 83 OS=Homo sapiens G... 30 7.1
sp|Q9C0I4|THS7B_HUMAN Thrombospondin type-1 domain-containing pr... 30 7.1
sp|Q8IY33|MILK2_HUMAN MICAL-like protein 2 OS=Homo sapiens GN=MI... 30 7.1
sp|Q9Y219|JAG2_HUMAN Protein jagged-2 OS=Homo sapiens GN=JAG2 PE... 30 7.1
sp|Q91661|GLI4_XENLA Zinc finger protein GLI4 OS=Xenopus laevis ... 30 7.1
sp|P61754|SOX9_PONPY Transcription factor SOX-9 OS=Pongo pygmaeu... 30 9.2
sp|Q9BG89|SOX9_PANTR Transcription factor SOX-9 OS=Pan troglodyt... 30 9.2
sp|P61753|SOX9_MACMU Transcription factor SOX-9 OS=Macaca mulatt... 30 9.2
sp|P48436|SOX9_HUMAN Transcription factor SOX-9 OS=Homo sapiens ... 30 9.2
sp|Q9BG91|SOX9_CALJA Transcription factor SOX-9 OS=Callithrix ja... 30 9.2
sp|A5D7F8|SH3R1_BOVIN Putative E3 ubiquitin-protein ligase SH3RF... 30 9.2
sp|Q28GL3|RNFT1_XENTR RING finger and transmembrane domain-conta... 30 9.2
sp|Q80V70|MEGF6_MOUSE Multiple epidermal growth factor-like doma... 30 9.2

>sp|Q6ZRP5|YD019_HUMAN Putative uncharacterized protein FLJ46204
OS=Homo sapiens PE=2 SV=2
Length = 223

Score = 43.5 bits (101), Expect = 6e-04
Identities = 35/118 (29%), Positives = 49/118 (41%), Gaps = 2/118 (1%)
Frame = -3

Query: 483 HTHTLDATCRFWHIAYTHTPAINAQSMLGTCFQL-THTHTHSITGCNMWSALHKSHRSFR 307
HTHT T H+ HTP + + T + TH HTH+ T + + H +H
Sbjct: 85 HTHTGMHTLTGTHV---HTPHTQMHTRILTLSHMHTHAHTHAHTHGHTHTRAHSTHAHTH 141

Query: 306 SHTPLAWNNTLAQHVHAPP-GLARCRRWLRQDTHTHTPSTPRLCYMAHTHTRTLSLTH 136
+H+ H HA L + TH HT ++ T TRTL+LTH
Sbjct: 142 AHSHYHTRTLTLTHSHAHSCTLTSTITHMHTHTHMHTHTS--------TLTRTLTLTH 191



Score = 42.4 bits (98), Expect = 0.001
Identities = 25/83 (30%), Positives = 36/83 (43%)
Frame = -3

Query: 381 THTHTHSITGCNMWSALHKSHRSFRSHTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTH 202
THTH H+ TG + + H + HT + + + H H TH H
Sbjct: 80 THTHMHTHTGMHTLTGTHVHTPHTQMHTRILTLSHMHTHAHTHAHTHGHTHTRAHSTHAH 139

Query: 201 TPSTPRLCYMAHTHTRTLSLTHA 133
T + +H HTRTL+LTH+
Sbjct: 140 THA------HSHYHTRTLTLTHS 156


>sp|Q99MH6|NKD1_MOUSE Protein naked cuticle homolog 1 OS=Mus
musculus GN=Nkd1 PE=1 SV=1
Length = 471

Score = 37.0 bits (84), Expect = 0.058
Identities = 22/51 (43%), Positives = 24/51 (47%), Gaps = 1/51 (1%)
Frame = -2

Query: 334 AAQKPPVFPVTHTTCLE*HASPARACPTRPCSLPTLAPSRH-THAHTLDSS 185
A KPP+ P THT SP+ T P LPTLAP H H H S
Sbjct: 365 ARSKPPLVPTTHTV------SPSAHLATSPALLPTLAPLGHKKHKHRAKES 409


>sp|Q502M8|EXOD1_DANRE Exonuclease domain-containing protein 1
OS=Danio rerio GN=exod1 PE=2 SV=1
Length = 555

Score = 27.3 bits (59), Expect(2) = 0.57
Identities = 14/42 (33%), Positives = 24/42 (57%)
Frame = -1

Query: 488 SNTHTLSMPLADFGTLHTHTHLP*MRNPCSALASNSHTHTHT 363
+NTH ++ + +THTHL ++N ++HTHT+T
Sbjct: 274 TNTHLTNVKNSRDTHTNTHTHLTSVKN-----TRDTHTHTNT 310



Score = 24.3 bits (51), Expect(2) = 0.57
Identities = 24/86 (27%), Positives = 37/86 (43%), Gaps = 20/86 (23%)
Frame = -2

Query: 304 THTTCLE*HASPARACPTR-PCSLPTLAPSRHTH-----AHTLDS------------SP- 182
THT + +R TR P + +RHTH A++ D+ SP
Sbjct: 306 THTNTHLTNVKSSRDAHTRLPALMNGSIRARHTHTQQTCANSSDTHIASASVCEVLVSPY 365

Query: 181 -VLHGSHTYTHFVTHSCSSGGLADAS 107
+L +HT+TH S + GL+D +
Sbjct: 366 TLLSVAHTHTHLQARSAALAGLSDTT 391


>sp|Q6NTV1|RNFT1_XENLA RING finger and transmembrane
domain-containing protein 1 OS=Xenopus laevis GN=rnft1
PE=2 SV=2
Length = 416

Score = 28.5 bits (62), Expect(2) = 0.58
Identities = 14/30 (46%), Positives = 15/30 (50%)
Frame = -1

Query: 311 SGHTHHLLGITR*PSTCMPHPALLAADAGS 222
S HTHH LG PS CM P + GS
Sbjct: 30 SDHTHHQLGSNDSPSACMSLPVPQLSAEGS 59



Score = 23.1 bits (48), Expect(2) = 0.58
Identities = 11/27 (40%), Positives = 13/27 (48%)
Frame = -2

Query: 184 PVLHGSHTYTHFVTHSCSSGGLADASD 104
P HG H THS + G DA+D
Sbjct: 87 PSTHGRSPSRHGHTHSHDASGPEDAND 113


>sp|Q8JGR7|INT7_DANRE Integrator complex subunit 7 OS=Danio rerio
GN=ints7 PE=2 SV=1
Length = 964

Score = 32.0 bits (71), Expect = 1.9
Identities = 16/41 (39%), Positives = 21/41 (51%)
Frame = -3

Query: 276 LAQHVHAPPGLARCRRWLRQDTHTHTPSTPRLCYMAHTHTR 154
+ QH+H LA C R L Q+ + PST L HT T+
Sbjct: 200 MLQHMHHDASLASCSRELLQELVSSYPSTSMLIVTLHTFTQ 240


>sp|O13588|YA069_YEAST Putative uncharacterized protein YAL069W
OS=Saccharomyces cerevisiae GN=YAL069W PE=5 SV=1
Length = 104

Score = 31.6 bits (70), Expect = 2.4
Identities = 12/23 (52%), Positives = 16/23 (69%)
Frame = -1

Query: 491 ISNTHTLSMPLADFGTLHTHTHL 423
++NTH L++PL T HTH HL
Sbjct: 3 VNNTHVLTLPLYTTTTCHTHPHL 25


>sp|P06333|TCB1_RABIT T-cell receptor beta chain ANA 11
OS=Oryctolagus cuniculus PE=4 SV=1
Length = 319

Score = 31.6 bits (70), Expect = 2.4
Identities = 16/34 (47%), Positives = 17/34 (50%)
Frame = -2

Query: 502 WLGASATHTHSRCHLPILAHCIHTHTCHKCAIHA 401
+L S TH HS P C HTHTC IHA
Sbjct: 44 FLWPSHTHRHSYLLHPHTHVCTHTHTCTHTHIHA 77


>sp|Q3TDN0|DISP1_MOUSE Protein dispatched homolog 1 OS=Mus musculus
GN=Disp1 PE=1 SV=2
Length = 1521

Score = 31.6 bits (70), Expect = 2.4
Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 1/54 (1%)
Frame = -3

Query: 318 RSFRSHTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTHTPSTPRL-CYMAHTH 160
++ R P A+++ L + + PG A + L QDT H PR C A+TH
Sbjct: 1223 KNLRMPVPAAYSSELTKSPSSEPGSALLQSCLEQDTVCHFSLNPRCNCRDAYTH 1276


>sp|Q80YX1|TENA_MOUSE Tenascin OS=Mus musculus GN=Tnc PE=1 SV=1
Length = 2110

Score = 31.2 bits (69), Expect = 3.2
Identities = 15/36 (41%), Positives = 18/36 (50%), Gaps = 12/36 (33%)
Frame = +1

Query: 364 VCVC------------VCELEASAEHGLRIYGRCVC 435
VCVC VC + S EHG+ + GRCVC
Sbjct: 235 VCVCFEGYAGPDCGLEVCPVPCSEEHGMCVDGRCVC 270


>sp|Q7TQM3|FGRL1_RAT Fibroblast growth factor receptor-like 1
OS=Rattus norvegicus GN=Fgfrl1 PE=2 SV=1
Length = 529

Score = 31.2 bits (69), Expect = 3.2
Identities = 17/50 (34%), Positives = 23/50 (46%)
Frame = -2

Query: 235 PTLAPSRHTHAHTLDSSPVLHGSHTYTHFVTHSCSSGGLADASDLPPQAV 86
P L P +T HT HT+TH TH+ S GG ++ P +V
Sbjct: 457 PKLYPKLYTDVHT----------HTHTHTCTHTLSCGGQGSSAPACPLSV 496


tr_hit_id B6PK07
Definition tr|B6PK07|B6PK07_BRAFL Putative uncharacterized protein (Fragment) OS=Branchiostoma floridae
Align length 148
Score (bit) 48.1
E-value 0.0003
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912874|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_H01.
(527 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6PK07|B6PK07_BRAFL Putative uncharacterized protein (Fragmen... 48 3e-04
tr|A8Q8Z6|A8Q8Z6_BRUMA T-cell receptor beta chain ANA 11, putati... 47 8e-04
tr|A9V4H4|A9V4H4_MONBE Predicted protein OS=Monosiga brevicollis... 46 0.001
tr|B6MRE1|B6MRE1_BRAFL Putative uncharacterized protein OS=Branc... 42 0.015
tr|A9V7Z1|A9V7Z1_MONBE Predicted protein OS=Monosiga brevicollis... 42 0.019
tr|A7RRF7|A7RRF7_NEMVE Predicted protein (Fragment) OS=Nematoste... 42 0.019
tr|Q6ZS38|Q6ZS38_HUMAN cDNA FLJ45860 fis, clone OCBBF2036019, mo... 41 0.032
tr|B7WNX1|B7WNX1_HUMAN Putative uncharacterized protein ENSP0000... 41 0.032
tr|A8MYS4|A8MYS4_HUMAN Putative uncharacterized protein ENSP0000... 41 0.042
tr|A6NFT5|A6NFT5_HUMAN Putative uncharacterized protein ENSP0000... 41 0.042
tr|B6PM67|B6PM67_BRAFL Putative uncharacterized protein OS=Branc... 40 0.055
tr|A8P703|A8P703_BRUMA Histidine-rich glycoprotein, putative OS=... 40 0.055
tr|Q9PH93|Q9PH93_XYLFA Putative uncharacterized protein OS=Xylel... 40 0.094
tr|B6MRE3|B6MRE3_BRAFL Putative uncharacterized protein OS=Branc... 39 0.12
tr|Q9VJ40|Q9VJ40_DROME CG17321 OS=Drosophila melanogaster GN=CG1... 39 0.16
tr|B6M838|B6M838_BRAFL Putative uncharacterized protein OS=Branc... 39 0.16
tr|B4P9Z3|B4P9Z3_DROYA GE13212 OS=Drosophila yakuba GN=GE13212 P... 39 0.16
tr|B4I5L9|B4I5L9_DROSE GM17299 OS=Drosophila sechellia GN=GM1729... 39 0.16
tr|B3NL86|B3NL86_DROER GG21138 OS=Drosophila erecta GN=GG21138 P... 39 0.16
tr|B3MUE9|B3MUE9_DROAN GF24654 OS=Drosophila ananassae GN=GF2465... 39 0.16
tr|A8MYM1|A8MYM1_HUMAN Putative uncharacterized protein ENSP0000... 39 0.16
tr|A8MTI4|A8MTI4_HUMAN Putative uncharacterized protein ENSP0000... 39 0.16
tr|B6MH37|B6MH37_BRAFL Putative uncharacterized protein (Fragmen... 39 0.21
tr|Q59F30|Q59F30_HUMAN Fibroblast growth factor receptor 4 varia... 29 0.25
tr|B6MRW8|B6MRW8_BRAFL Putative uncharacterized protein OS=Branc... 38 0.27
tr|A8P802|A8P802_BRUMA Putative uncharacterized protein OS=Brugi... 38 0.36
tr|A7T7I7|A7T7I7_NEMVE Predicted protein (Fragment) OS=Nematoste... 38 0.36
tr|Q4T021|Q4T021_TETNG Chromosome undetermined SCAF11390, whole ... 34 0.42
tr|Q4RNI9|Q4RNI9_TETNG Adenylosuccinate synthetase OS=Tetraodon ... 31 0.43
tr|B6M9N9|B6M9N9_BRAFL Putative uncharacterized protein OS=Branc... 37 0.47

>tr|B6PK07|B6PK07_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_251887 PE=4 SV=1
Length = 132

Score = 48.1 bits (113), Expect = 3e-04
Identities = 42/148 (28%), Positives = 56/148 (37%), Gaps = 19/148 (12%)
Frame = -3

Query: 480 THTLDATCRFWHIAYTHTPAINAQSMLGTCFQLTHTHTHSITGCNMWSALHKSHRSFRSH 301
THT D + +TH P LTHTH ++T + AL +H + RSH
Sbjct: 1 THTHDPA-----LTHTHDPV------------LTHTHDPALTYTHD-PALTYTHTTLRSH 42

Query: 300 T----PLAWNNTLAQHVHAPPGLARCRRWL---------------RQDTHTHTPSTPRLC 178
T P + L H H P L R W R TH P+ R C
Sbjct: 43 THGPVPTHTHTALRLHTH-DPALTHTRPWCAYTYTRPCAYTHTTQRLHTHNPAPTHTRPC 101

Query: 177 YMAHTHTRTLSLTHAAPEASPMPVIYLH 94
HTHT T H + +A + ++H
Sbjct: 102 SYTHTHTHTPLRLHTSYDAHALKYSHIH 129


>tr|A8Q8Z6|A8Q8Z6_BRUMA T-cell receptor beta chain ANA 11, putative
OS=Brugia malayi GN=Bm1_46665 PE=4 SV=1
Length = 130

Score = 46.6 bits (109), Expect = 8e-04
Identities = 27/93 (29%), Positives = 41/93 (44%), Gaps = 3/93 (3%)
Frame = -3

Query: 381 THTHTHSITGCNMWSALHKSHRSFRSHTPLAWNNTLAQHVHAPPGLARCRRWLRQD---T 211
THTHTH+ T + + H H +HT + H H P + +++ +
Sbjct: 20 THTHTHTHTHTHTHTHTHTLHTHTHTHTHT--HTHTHTHTHNMPTIRPVHSYIQNNKVCA 77

Query: 210 HTHTPSTPRLCYMAHTHTRTLSLTHAAPEASPM 112
HT T + +C HTHT T + TH P P+
Sbjct: 78 HTRTHTYEHVCTHTHTHTDTYTDTHNMPTNRPV 110



Score = 33.9 bits (76), Expect = 5.2
Identities = 30/109 (27%), Positives = 38/109 (34%)
Frame = -1

Query: 488 SNTHTLSMPLADFGTLHTHTHLP*MRNPCSALASNSHTHTHTL*QDATCGLRCTKATGLS 309
++THT + TLHTHTH +++HTHTHT
Sbjct: 24 THTHTHTHTHTHTHTLHTHTH------------THTHTHTHT-----------------H 54

Query: 308 GHTHHLLGITR*PSTCMPHPALLAADAGSVKTHTRTHPRLLACATWLTH 162
HTH++ I P V HTRTH C TH
Sbjct: 55 THTHNMPTI---------RPVHSYIQNNKVCAHTRTHTYEHVCTHTHTH 94


>tr|A9V4H4|A9V4H4_MONBE Predicted protein OS=Monosiga brevicollis
GN=33273 PE=4 SV=1
Length = 473

Score = 45.8 bits (107), Expect = 0.001
Identities = 42/122 (34%), Positives = 55/122 (45%), Gaps = 7/122 (5%)
Frame = -1

Query: 482 THTLSMPLA-DFGTLHTHTHLP*MRNPCSALASNSHTHTHTL*QDATCGLRCTKATGLS- 309
TH+L+ PL F TH H P + S ++HTHTHTL + L T + LS
Sbjct: 3 THSLTHPLCHSFTHSLTHCHSPTL----SLTHCHTHTHTHTLSLSLSLSLSLTLSHTLSQ 58

Query: 308 --GHTHHL-LGITR*PSTCMPHPALLAADAGSVKTH--TRTHPRLLACATWLTHIHALCH 144
HTH L +T + + H L TH T TH L + L+H H+L H
Sbjct: 59 SLSHTHSLNHSLTHSLTQSLSHTHSLNHSLTHSLTHSLTLTHTLSLTLSHTLSHTHSLNH 118

Query: 143 SL 138
SL
Sbjct: 119 SL 120



Score = 34.7 bits (78), Expect = 3.0
Identities = 38/128 (29%), Positives = 49/128 (38%), Gaps = 11/128 (8%)
Frame = -1

Query: 488 SNTHTLS---MPLADFGTLHTHTHLP*MRNPCSA--------LASNSHTHTHTL*QDATC 342
S TH+L+ P HTHTH + S S S +HTH+L T
Sbjct: 13 SFTHSLTHCHSPTLSLTHCHTHTHTHTLSLSLSLSLSLTLSHTLSQSLSHTHSLNHSLTH 72

Query: 341 GLRCTKATGLSGHTHHLLGITR*PSTCMPHPALLAADAGSVKTHTRTHPRLLACATWLTH 162
L T HTH L + + H L +HT +H L + LTH
Sbjct: 73 SL-----TQSLSHTHSL---NHSLTHSLTHSLTLTHTLSLTLSHTLSHTHSLNHS--LTH 122

Query: 161 IHALCHSL 138
H+L HSL
Sbjct: 123 THSLTHSL 130



Score = 34.3 bits (77), Expect = 4.0
Identities = 37/132 (28%), Positives = 53/132 (40%), Gaps = 7/132 (5%)
Frame = -3

Query: 480 THTLDATCRFWHI-AYTHTPAINAQSMLGTCFQLTHT------HTHSITGCNMWSALHKS 322
TH T H +THT ++ L L+HT HTHS+ S H
Sbjct: 19 THCHSPTLSLTHCHTHTHTHTLSLSLSLSLSLTLSHTLSQSLSHTHSLNH----SLTHSL 74

Query: 321 HRSFRSHTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTHTPSTPRLCYMAHTHTRTLSL 142
+S SHT + N++L + L T +HT S + HTH+ T SL
Sbjct: 75 TQSL-SHTH-SLNHSLTHSLTHSLTLTHTLSLTLSHTLSHTHSLNHS--LTHTHSLTHSL 130

Query: 141 THAAPEASPMPV 106
TH+ + + V
Sbjct: 131 THSLTHSHNLSV 142


>tr|B6MRE1|B6MRE1_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_85728 PE=4 SV=1
Length = 411

Score = 42.4 bits (98), Expect = 0.015
Identities = 34/117 (29%), Positives = 46/117 (39%), Gaps = 6/117 (5%)
Frame = -3

Query: 495 AHQQHTHTLDATCRFWHIAYTHTPAINAQSM------LGTCFQLTHTHTHSITGCNMWSA 334
AH THTL CR H T + + ++ L TC THT G +
Sbjct: 266 AHSVDTHTL---CRNAHTLQTRAHSADTCTLCRYTHTLQTCAHTAATHTQCRHGYTQQTC 322

Query: 333 LHKSHRSFRSHTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTHTPSTPRLCYMAHT 163
H + + R+H A +TL H+ CR T TH+ T LC + HT
Sbjct: 323 AHSA--AMRTHCRHA--HTLQTRAHSADTRTLCRHAHTLQTRTHSADTRTLCRLVHT 375



Score = 39.7 bits (91), Expect = 0.094
Identities = 45/145 (31%), Positives = 53/145 (36%), Gaps = 18/145 (12%)
Frame = -3

Query: 495 AHQQHTHTLDATCRFWHIAYTHTPAINAQSMLG----TCFQLTHTHT-----HSI---TG 352
AH T TL CR H A THT + TC H HT HS T
Sbjct: 65 AHSADTRTL---CRHAHSADTHTCHMQTLQTCAHSADTCTLCRHAHTLQTRAHSAATRTL 121

Query: 351 CNMWSALHKSHRSFRSHTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTHTPSTPRLCYM 172
C+ L S + T +TL H H+ CR +H+ T LC
Sbjct: 122 CSHTHTLQTRTHSADTCTLCRHVHTLQLHAHSADMCTLCRHVHTLQPRSHSADTRTLCSH 181

Query: 171 AHT-HTR-----TLSLTHAAPEASP 115
AHT TR T +L A ASP
Sbjct: 182 AHTLQTRPHSADTRTLQTRAHSASP 206



Score = 34.3 bits (77), Expect = 4.0
Identities = 37/131 (28%), Positives = 45/131 (34%), Gaps = 20/131 (15%)
Frame = -3

Query: 495 AHQQHTHTLDATCRFWHIAYTHTPAINAQSMLGTCFQLTHTHT-----HSITGCNMWSAL 331
AH T TL C H T T + + TC H HT HS C + +
Sbjct: 113 AHSAATRTL---CSHTHTLQTRTHSAD------TCTLCRHVHTLQLHAHSADMCTLCRHV 163

Query: 330 H----KSH----RSFRSHTPL-------AWNNTLAQHVHAPPGLARCRRWLRQDTHTHTP 196
H +SH R+ SH A TL H+ CR T H+
Sbjct: 164 HTLQPRSHSADTRTLCSHAHTLQTRPHSADTRTLQTRAHSASPRTLCRHAHTLQTRAHSA 223

Query: 195 STPRLCYMAHT 163
S LC AHT
Sbjct: 224 SPRTLCIPAHT 234



Score = 33.5 bits (75), Expect = 6.7
Identities = 36/133 (27%), Positives = 50/133 (37%), Gaps = 27/133 (20%)
Frame = -3

Query: 447 HIAYTHTPAINAQSMLGTCFQLTHTHTHSI-TGCNMWSALHKSHRSFRSHTPLAWNNTLA 271
H + HT ++A S T +H H+ ++ T C+ L S + T +TL
Sbjct: 4 HCRHAHTLQLHAHSA-DTRTLCSHAHSAAMHTLCSHAHTLQSRTHSAATRTLCRHAHTLQ 62

Query: 270 QHVHAPPGLARCRRWLRQDTHT----------HTPSTPRLCYMAHT-------------- 163
H+ CR DTHT H+ T LC AHT
Sbjct: 63 TRAHSADTRTLCRHAHSADTHTCHMQTLQTCAHSADTCTLCRHAHTLQTRAHSAATRTLC 122

Query: 162 -HTRTL-SLTHAA 130
HT TL + TH+A
Sbjct: 123 SHTHTLQTRTHSA 135



Score = 33.5 bits (75), Expect = 6.7
Identities = 30/111 (27%), Positives = 38/111 (34%), Gaps = 3/111 (2%)
Frame = -3

Query: 486 QHTHTLDATCRFWHIAYTHT---PAINAQSMLGTCFQLTHTHTHSITGCNMWSALHKSHR 316
+H HTL H A T PA Q+ + THT T C L
Sbjct: 211 RHAHTLQTRA---HSASPRTLCIPAHTLQTRARSAATDTHTICRHSTQCRHVHTLQSRAH 267

Query: 315 SFRSHTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTHTPSTPRLCYMAHT 163
S +HT +TL H+ CR T HT +T C +T
Sbjct: 268 SVDTHTLCRNAHTLQTRAHSADTCTLCRYTHTLQTCAHTAATHTQCRHGYT 318


>tr|A9V7Z1|A9V7Z1_MONBE Predicted protein OS=Monosiga brevicollis
GN=28368 PE=4 SV=1
Length = 305

Score = 42.0 bits (97), Expect = 0.019
Identities = 39/135 (28%), Positives = 57/135 (42%), Gaps = 20/135 (14%)
Frame = -3

Query: 483 HTHTLDATCRFWHIAYTHTPAINAQSMLGTCFQL-------------THTHTHSITGCNM 343
HTHTL + ++ + T A++ L L +HTHTHS++ N
Sbjct: 86 HTHTLSLSLS---LSLSQTLALSLSLKLSLSLSLKLSLSLSPKLSLCSHTHTHSLSLSNS 142

Query: 342 WSALHKSHRSFRSHTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTHTPSTPR------- 184
S + S + L+ +N+ H + P R THTHT S +
Sbjct: 143 LSLSNSRSLSLSNSRSLSLSNS---HSLSLPNSLSAR------THTHTLSLSQTLSLSQT 193

Query: 183 LCYMAHTHTRTLSLT 139
L +AHTHT TLSL+
Sbjct: 194 LSLLAHTHTHTLSLS 208



Score = 35.0 bits (79), Expect = 2.3
Identities = 19/45 (42%), Positives = 27/45 (60%), Gaps = 1/45 (2%)
Frame = -1

Query: 491 ISNTHTLSMPLADFGTLHTHT-HLP*MRNPCSALASNSHTHTHTL 360
+SN+H+LS+P + HTHT L + L+ +HTHTHTL
Sbjct: 161 LSNSHSLSLPNSLSARTHTHTLSLSQTLSLSQTLSLLAHTHTHTL 205



Score = 33.1 bits (74), Expect = 8.8
Identities = 30/86 (34%), Positives = 40/86 (46%), Gaps = 12/86 (13%)
Frame = -1

Query: 488 SNTHTLSMPLADFGTLHTHTHLP*MRNPCSALASNSH-----------THTHTL*QDATC 342
S+THT S+ L++ +L L + N S SNSH THTHTL T
Sbjct: 130 SHTHTHSLSLSNSLSLSNSRSLS-LSNSRSLSLSNSHSLSLPNSLSARTHTHTLSLSQTL 188

Query: 341 GLRCTKATGLSGHTH-HLLGITR*PS 267
L ++ L HTH H L ++ PS
Sbjct: 189 SL--SQTLSLLAHTHTHTLSLSLSPS 212


>tr|A7RRF7|A7RRF7_NEMVE Predicted protein (Fragment) OS=Nematostella
vectensis GN=v1g37021 PE=4 SV=1
Length = 129

Score = 42.0 bits (97), Expect = 0.019
Identities = 36/112 (32%), Positives = 52/112 (46%), Gaps = 10/112 (8%)
Frame = -3

Query: 498 LAHQQHTHTLDATCR----FWHIAYTHTPAINAQSMLGTCFQLTH-THTHSITGCNMWSA 334
L HQ THTL++ H THTP + + LTH T TH+ G +
Sbjct: 14 LTHQTGTHTLNSYSHTQRVLTHPTGTHTPNRGSHAKQ----VLTHPTGTHTPNGYSHTKR 69

Query: 333 LHKSHRSFRSHTPLAWNNT---LAQHV--HAPPGLARCRRWLRQDTHTHTPS 193
+ R R+HTP +++T L H H P G + ++ L + T THTP+
Sbjct: 70 VLT--RPMRTHTPNGYSHTQQVLTHHTGTHIPNGYSHTKQGLTRQTGTHTPN 119


>tr|Q6ZS38|Q6ZS38_HUMAN cDNA FLJ45860 fis, clone OCBBF2036019,
moderately similar to NADH-ubiquinone oxidoreductase 20
kDa subunit, mitochondrial (EC 1.6.5.3) OS=Homo sapiens
PE=2 SV=1
Length = 294

Score = 41.2 bits (95), Expect = 0.032
Identities = 36/121 (29%), Positives = 48/121 (39%), Gaps = 5/121 (4%)
Frame = -3

Query: 483 HTHTLDATCRFWHIAYTHTPA-INAQSMLGTCFQLTHTHTHSITGCNMWSALHKSHRSFR 307
HTHT T A T T A ++A S + T HTHTH+ H +H R
Sbjct: 99 HTHTNVQTRTHTTHACTLTCAHVHASSHVWTDVYTDHTHTHA----------HNAHMHTR 148

Query: 306 SHTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTH----TPSTPRLCYMAHTHTRTLSLT 139
+H L + + H + C L TH H T + C H+H T +LT
Sbjct: 149 THAHLHTHAHTSTCAHTLAHIHTCTLALMH-THAHIYTCTRTLAHTCTYMHSHAHTCTLT 207

Query: 138 H 136
H
Sbjct: 208 H 208



Score = 40.0 bits (92), Expect = 0.072
Identities = 23/86 (26%), Positives = 34/86 (39%), Gaps = 5/86 (5%)
Frame = -3

Query: 378 HTHTHSITGCNMWSALHKSHRSFRSHTPL-----AWNNTLAQHVHAPPGLARCRRWLRQD 214
HTH H+ T N+ + H +H + + W + H H A
Sbjct: 93 HTHRHTHTHTNVQTRTHTTHACTLTCAHVHASSHVWTDVYTDHTHTHAHNAHMHTRTHAH 152

Query: 213 THTHTPSTPRLCYMAHTHTRTLSLTH 136
HTH ++ +AH HT TL+L H
Sbjct: 153 LHTHAHTSTCAHTLAHIHTCTLALMH 178



Score = 35.0 bits (79), Expect = 2.3
Identities = 31/122 (25%), Positives = 43/122 (35%), Gaps = 4/122 (3%)
Frame = -2

Query: 484 THTHSRCHLPILAHCIHTHTCHKCAIHARXXXXXXXXXXXLYNRMQHVVCAAQKPPVFPV 305
TH H+ H + THT H C + +Y H A +
Sbjct: 94 THRHTHTHTNVQTR---THTTHACTLTCAHVHASSHVWTDVYT--DHTHTHAHNAHMHTR 148

Query: 304 THTTCLE*HASPARACPT----RPCSLPTLAPSRHTHAHTLDSSPVLHGSHTYTHFVTHS 137
TH L HA + T C+L + HTHAH + L + TY H H+
Sbjct: 149 THAH-LHTHAHTSTCAHTLAHIHTCTLALM----HTHAHIYTCTRTLAHTCTYMHSHAHT 203

Query: 136 CS 131
C+
Sbjct: 204 CT 205



Score = 34.3 bits (77), Expect = 4.0
Identities = 35/125 (28%), Positives = 47/125 (37%), Gaps = 9/125 (7%)
Frame = -1

Query: 488 SNTHTLSMPLADFGTLHTHTHLP*MRNPCSALASNSHTHTHTL*QDATCG------LRCT 327
++ H S D T HTHTH + + + +H H HT +TC CT
Sbjct: 119 AHVHASSHVWTDVYTDHTHTHA-----HNAHMHTRTHAHLHTHAHTSTCAHTLAHIHTCT 173

Query: 326 KATGLSGHTH-HLLGITR*PSTCMPHPALLAADAGSVKTHTRTHPRLLACATW--LTHIH 156
A HTH H+ TR + + A HTR CA W T H
Sbjct: 174 LAL---MHTHAHIYTCTRTLAHTCTYMHSHAHTCTLTHMHTRPCVDTCMCACWHACTQAH 230

Query: 155 ALCHS 141
+L H+
Sbjct: 231 SLMHT 235



Score = 33.1 bits (74), Expect = 8.8
Identities = 31/100 (31%), Positives = 38/100 (38%), Gaps = 11/100 (11%)
Frame = -1

Query: 401 SALASNSHTHTHTL*QDAT-----CGLRCTKATGLSGHTHHLLGITR*PSTCMPHPALLA 237
++L ++ HTHTHT Q T C L C H H + T H
Sbjct: 90 ASLHTHRHTHTHTNVQTRTHTTHACTLTC-------AHVHASSHVWTDVYTDHTH----- 137

Query: 236 ADAGSVKTHTRTHPRL------LACATWLTHIHALCHSLM 135
A + HTRTH L CA L HIH +LM
Sbjct: 138 THAHNAHMHTRTHAHLHTHAHTSTCAHTLAHIHTCTLALM 177


>tr|B7WNX1|B7WNX1_HUMAN Putative uncharacterized protein
ENSP00000369593 OS=Homo sapiens PE=4 SV=1
Length = 406

Score = 41.2 bits (95), Expect = 0.032
Identities = 33/117 (28%), Positives = 48/117 (41%)
Frame = -3

Query: 483 HTHTLDATCRFWHIAYTHTPAINAQSMLGTCFQLTHTHTHSITGCNMWSALHKSHRSFRS 304
HTHTL C HI YTH + + THTH H+ T + + H H +
Sbjct: 197 HTHTL--ACTQIHI-YTHIYMHAHTPIHSHIYTWTHTHAHTYTHIHSHAHTH-IHMHIHT 252

Query: 303 HTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTHTPSTPRLCYMAHTHTRTLSLTHA 133
+T + + H H + C + H +T + + HTHT T + THA
Sbjct: 253 YTHMHTHMDTYPHTH----IHTCTH-MHSHAHINTYTHAHIHMHMHTHTHTHTYTHA 304



Score = 38.9 bits (89), Expect = 0.16
Identities = 35/150 (23%), Positives = 56/150 (37%), Gaps = 20/150 (13%)
Frame = -3

Query: 483 HTHTLDATCRFWHI-AYTHTPAINAQSMLGTCFQLTHTHTHSITGCNMWSALHK------ 325
HTHT H+ YTHT Q+ + TC +H H H T ++ +H
Sbjct: 148 HTHTCIHIHSDTHLHIYTHTTC--TQTQIHTCTH-SHIHIHMPTHTRTYTHMHTHTLACT 204

Query: 324 -----SHRSFRSHTPL-----AWNNTLAQ---HVHAPPGLARCRRWLRQDTHTHTPSTPR 184
+H +HTP+ W +T A H+H+ + HT+T
Sbjct: 205 QIHIYTHIYMHAHTPIHSHIYTWTHTHAHTYTHIHS-----HAHTHIHMHIHTYTHMHTH 259

Query: 183 LCYMAHTHTRTLSLTHAAPEASPMPVIYLH 94
+ HTH T + H+ + ++H
Sbjct: 260 MDTYPHTHIHTCTHMHSHAHINTYTHAHIH 289



Score = 36.6 bits (83), Expect = 0.80
Identities = 35/136 (25%), Positives = 50/136 (36%), Gaps = 6/136 (4%)
Frame = -3

Query: 483 HTHTLDATCRFWHI-AYTHTPAINAQSMLGTCFQL-----THTHTHSITGCNMWSALHKS 322
HTH T + HI TH I++ TC + TH HTH++ N +
Sbjct: 2 HTHMHIYTHAYTHIHTCTH---IHSHIHTFTCTHIHRRTYTHRHTHTLMHTNKYIY---- 54

Query: 321 HRSFRSHTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTHTPSTPRLCYMAHTHTRTLSL 142
H SH + + H H T+THT + R H HT +
Sbjct: 55 HMHIHSHAHRHIHTHICTHAHTL-------------TYTHTCTYKRTYIQGHIHTHMHTY 101

Query: 141 THAAPEASPMPVIYLH 94
THA A +++H
Sbjct: 102 THAHTHAHIHIHVHIH 117



Score = 35.8 bits (81), Expect = 1.4
Identities = 30/121 (24%), Positives = 41/121 (33%), Gaps = 4/121 (3%)
Frame = -3

Query: 483 HTHTLDATCRFWHIAYTHTPA-INAQSMLGTCFQL---THTHTHSITGCNMWSALHKSHR 316
HT T TC + + THT I TC + TH H ++ T C +H
Sbjct: 122 HTCTHIYTCTYT-VVCTHTHMHIYTHVHTHTCIHIHSDTHLHIYTHTTCTQTQIHTCTHS 180

Query: 315 SFRSHTPLAWNNTLAQHVHAPPGLARCRRWLRQDTHTHTPSTPRLCYMAHTHTRTLSLTH 136
H P H H + + H HTP + HTH T + H
Sbjct: 181 HIHIHMPTHTRTYTHMHTHTL-ACTQIHIYTHIYMHAHTPIHSHIYTWTHTHAHTYTHIH 239

Query: 135 A 133
+
Sbjct: 240 S 240


>tr|A8MYS4|A8MYS4_HUMAN Putative uncharacterized protein
ENSP00000380660 (Fragment) OS=Homo sapiens PE=4 SV=1
Length = 207

Score = 40.8 bits (94), Expect = 0.042
Identities = 42/154 (27%), Positives = 57/154 (37%), Gaps = 24/154 (15%)
Frame = -3

Query: 483 HTHTLDATCRFWHIAYTHTPAINAQSMLGTCFQLTHTHTHSITGCNMWSALH-KSHRS-- 313
HT T T H +THTP+++ + TH H H+ T ++ H +HR
Sbjct: 49 HTRTHAHTHPHGH-THTHTPSMDTHTRT-----YTHPHGHTYTYTRAYTHPHGHTHRPTL 102

Query: 312 FRSHTPLAWNNTLAQHVHA-------PPGLARCRRWLRQDTHTHTPS---TPRLCY---- 175
+HTP+ + H H PP W THTHTP+ T Y
Sbjct: 103 MDTHTPILMDTHAYTHPHGHTHMHIHPPS------WTHTRTHTHTPTLMDTHTRTYTHPH 156

Query: 174 -------MAHTHTRTLSLTHAAPEASPMPVIYLH 94
+ THT L THA P + H
Sbjct: 157 GHTHRPTLMDTHTPILMDTHAHTHIHPSSWTHTH 190



Score = 34.3 bits (77), Expect = 4.0
Identities = 23/73 (31%), Positives = 32/73 (43%), Gaps = 5/73 (6%)
Frame = -1

Query: 500 AWRISNTHTLSMPLADFGTL-----HTHTHLP*MRNPCSALASNSHTHTHTL*QDATCGL 336
+W + THT + L D T H HTH P + + + + ++H HTH T
Sbjct: 131 SWTHTRTHTHTPTLMDTHTRTYTHPHGHTHRPTLMDTHTPILMDTHAHTHIHPSSWTHTH 190

Query: 335 RCTKATGLSGHTH 297
C T GHTH
Sbjct: 191 TCA-YTHPHGHTH 202


>tr|A6NFT5|A6NFT5_HUMAN Putative uncharacterized protein
ENSP00000369591 OS=Homo sapiens PE=4 SV=2
Length = 175

Score = 40.8 bits (94), Expect = 0.042
Identities = 36/142 (25%), Positives = 52/142 (36%), Gaps = 31/142 (21%)
Frame = -3

Query: 483 HTHTLDATCRFWHI-AYTHTPA-INAQSMLGTCFQL-----------THTHTHSITGCNM 343
HTH T + HI +THT I Q+ + +C Q+ T THTH T +
Sbjct: 28 HTHMHTHTLTYTHIHMHTHTQTHIYTQAHIHSCTQINIYTYAYTLTCTQTHTHICTHAHT 87

Query: 342 WSALH-----------KSHRSFRSHTPLAWNNTLAQHVHAPPGL-------ARCRRWLRQ 217
+ H + H HT +H+HA + +
Sbjct: 88 LTYTHIHTCTYKRTYIQGHIHTHMHTYTCTCTHTHKHIHAHIHIHTHTHIYTHTDAYTHM 147

Query: 216 DTHTHTPSTPRLCYMAHTHTRT 151
DT+THT +C +HTH T
Sbjct: 148 DTYTHTYPHTHICIHSHTHAHT 169