BP912878
Clone id YMU001_000023_H05
Library
Length 236
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000023_H05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTTTTTCATCAGCAAAAGACACAACCTGTTCCTCCTTGCCCCGATAAAAAAGGTCAGAAA
AGCGCTCATGTTGTCAGCACACCAGAGATGCCCTCTCTGGGTAGTGGCAGGCTTCAATTC
ATCTCCGGCAGGCTTCAAGACATGGAGATGACGCCACACACTGTACTGACCACACGACTG
AGGAATAGGACCAAAGGTGAATCAACGCTATCAAGCAAGGGCAGACAGAGTCCAGG
■■Homology search results ■■ -
sp_hit_id P95968
Definition sp|P95968|SYE_SULSO Glutamyl-tRNA synthetase OS=Sulfolobus solfataricus
Align length 41
Score (bit) 29.3
E-value 6.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912878|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_H05.
(236 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P95968|SYE_SULSO Glutamyl-tRNA synthetase OS=Sulfolobus solfa... 29 6.4
sp|A8CG34|P121C_HUMAN Nuclear envelope pore membrane protein POM... 29 6.4
sp|Q96HA1|P121A_HUMAN Nuclear envelope pore membrane protein POM... 29 6.4

>sp|P95968|SYE_SULSO Glutamyl-tRNA synthetase OS=Sulfolobus
solfataricus GN=gltX PE=3 SV=1
Length = 575

Score = 29.3 bits (64), Expect = 6.4
Identities = 14/41 (34%), Positives = 22/41 (53%), Gaps = 1/41 (2%)
Frame = +1

Query: 7 HQQKTQPVPPCPDKKGQKSAHVVSTPEMP-SLGSGRLQFIS 126
H++K + +PP P+ KGQ P+ P LG+ R +S
Sbjct: 85 HEEKRKVLPPLPNVKGQVVTRFAPNPDGPLHLGNARSAILS 125


>sp|A8CG34|P121C_HUMAN Nuclear envelope pore membrane protein POM
121C OS=Homo sapiens GN=POM121C PE=1 SV=2
Length = 1229

Score = 29.3 bits (64), Expect = 6.4
Identities = 11/29 (37%), Positives = 16/29 (55%)
Frame = +1

Query: 13 QKTQPVPPCPDKKGQKSAHVVSTPEMPSL 99
Q +PPCP+ G + +S P+ PSL
Sbjct: 582 QTPPSLPPCPESAGAATTEALSPPKTPSL 610


>sp|Q96HA1|P121A_HUMAN Nuclear envelope pore membrane protein POM
121 OS=Homo sapiens GN=POM121 PE=1 SV=2
Length = 1249

Score = 29.3 bits (64), Expect = 6.4
Identities = 11/29 (37%), Positives = 16/29 (55%)
Frame = +1

Query: 13 QKTQPVPPCPDKKGQKSAHVVSTPEMPSL 99
Q +PPCP+ G + +S P+ PSL
Sbjct: 605 QTPPSLPPCPESAGAATTEALSPPKTPSL 633


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912878|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_H05.
(236 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******