BP912882
Clone id YMU001_000023_H09
Library
Length 455
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000023_H09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTAAGGTATAACTCGTCCTTCTCTGTGTTCGAATAAAAGCAATGTTTGAGGCCCACTATA
TTCGGATGCTCGAGCATTTGCATAATTTGCAGCTCACGGTTTTTGTAGCGTTTATCCTGC
AAAACCTTTTTAATGGCAACCATCTCTCCAGTCTCGATACACCTTGCTTGAAAAACGATT
CCAAAAGATCCAGTACCAACAACACGTTCGGCCATATAGCTAATAACCTGCTTTTGTTGC
CCATTTGAGCCTGCCACTGCTGTCACAATGATGTTGCCAGACTCCGTGCTGTTGCTATTA
GCAAGAGCCGTTGCTCCCTCCTTGTCATTGCCGCTATCGTCCAGCCTATTGTCTCGCAGC
TTCATCTCAAGCATCTCCCTCGGCAGCTGATCTACACCTCCCTTTCCAGCAAATACTGTG
CTGGACCCTGCTCCTGTTCGAGCCACTCCTGGCTC
■■Homology search results ■■ -
sp_hit_id P51137
Definition sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS=Medicago sativa
Align length 150
Score (bit) 181.0
E-value 1.0e-45
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912882|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_H09.
(455 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1 OS... 181 1e-45
sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha OS=Arab... 181 1e-45
sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3 OS... 180 2e-45
sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase NtK-1 OS=Nico... 178 9e-45
sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma OS=Arab... 177 1e-44
sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homolog MsK-2 OS... 175 7e-44
sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon OS=Ar... 175 9e-44
sp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta OS=Arab... 174 2e-43
sp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta OS=Arab... 164 2e-40
sp|O04160|KSGT_BRANA Shaggy-related protein kinase theta OS=Bras... 162 5e-40
sp|Q39010|KSG6_ARATH Shaggy-related protein kinase zeta OS=Arabi... 162 8e-40
sp|Q39012|KSG9_ARATH Shaggy-related protein kinase iota OS=Arabi... 157 3e-38
sp|Q39011|KSG7_ARATH Shaggy-related protein kinase eta OS=Arabid... 155 6e-38
sp|Q39019|KSG10_ARATH Shaggy-related protein kinase kappa OS=Ara... 153 4e-37
sp|O23145|KSG2_ARATH Shaggy-related protein kinase beta OS=Arabi... 145 8e-35
sp|Q9U2Q9|GSK3_CAEEL Glycogen synthase kinase-3 OS=Caenorhabditi... 107 2e-23
sp|A8X5H5|GSK3_CAEBR Glycogen synthase kinase-3 OS=Caenorhabditi... 106 5e-23
sp|Q2NL51|GSK3A_MOUSE Glycogen synthase kinase-3 alpha OS=Mus mu... 105 1e-22
sp|P18265|GSK3A_RAT Glycogen synthase kinase-3 alpha OS=Rattus n... 104 2e-22
sp|P49840|GSK3A_HUMAN Glycogen synthase kinase-3 alpha OS=Homo s... 104 2e-22
sp|P51136|GSK3_DICDI Glycogen synthase kinase-3 OS=Dictyostelium... 103 5e-22
sp|P18266|GSK3B_RAT Glycogen synthase kinase-3 beta OS=Rattus no... 103 5e-22
sp|Q9WV60|GSK3B_MOUSE Glycogen synthase kinase-3 beta OS=Mus mus... 103 5e-22
sp|P49841|GSK3B_HUMAN Glycogen synthase kinase-3 beta OS=Homo sa... 103 5e-22
sp|P18431|SGG_DROME Protein kinase shaggy OS=Drosophila melanoga... 102 8e-22
sp|Q5YJC2|GSK3B_SPECI Glycogen synthase kinase-3 beta OS=Spermop... 100 3e-21
sp|P83101|GSK3H_DROME Putative glycogen synthase kinase-3 homolo... 97 4e-20
sp|P50873|MRK1_YEAST Serine/threonine-protein kinase MRK1 OS=Sac... 93 5e-19
sp|Q10452|GSK3_SCHPO Protein kinase gsk3 OS=Schizosaccharomyces ... 92 1e-18
sp|P38615|MDS1_YEAST Serine/threonine-protein kinase MDS1/RIM11 ... 91 2e-18

>sp|P51137|MSK1_MEDSA Glycogen synthase kinase-3 homolog MsK-1
OS=Medicago sativa GN=MSK-1 PE=2 SV=1
Length = 411

Score = 181 bits (459), Expect = 1e-45
Identities = 93/150 (62%), Positives = 111/150 (74%), Gaps = 1/150 (0%)
Frame = -1

Query: 449 GVARTGAGSSTVFAGKGGVDQ-LPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGN 273
GVA T + G+ GVD LP EM +MK+RD D+E + + N TE+G+
Sbjct: 5 GVAPTSGFREVLGDGEIGVDDILPEEMSDMKIRD--------DREMEATVVDGNGTETGH 56

Query: 272 IIVTAVAGSNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRE 93
IIVT + G NGQ KQ ISYMAERVVG GSFG+VFQA+C+ETGE VAIKKVLQDKRYKNRE
Sbjct: 57 IIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRE 116

Query: 92 LQIMQMLEHPNIVGLKHCFYSNTEKDELYL 3
LQ M++L+HPN+V LKHCF+S TEKDELYL
Sbjct: 117 LQTMRLLDHPNVVSLKHCFFSTTEKDELYL 146


>sp|P43288|KSG1_ARATH Shaggy-related protein kinase alpha
OS=Arabidopsis thaliana GN=ASK1 PE=2 SV=3
Length = 405

Score = 181 bits (459), Expect = 1e-45
Identities = 88/132 (66%), Positives = 105/132 (79%)
Frame = -1

Query: 398 GVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQKQVIS 219
GVD+LP EM +MK+RD DKE + + N TE+G+IIVT + G NGQ KQ IS
Sbjct: 17 GVDKLPEEMNDMKIRD--------DKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTIS 68

Query: 218 YMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQMLEHPNIVGLKHC 39
YMAERVVG GSFG+VFQA+C+ETGE VAIKKVLQD+RYKNRELQ M++L+HPN+V LKHC
Sbjct: 69 YMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHC 128

Query: 38 FYSNTEKDELYL 3
F+S TEKDELYL
Sbjct: 129 FFSTTEKDELYL 140


>sp|P51139|MSK3_MEDSA Glycogen synthase kinase-3 homolog MsK-3
OS=Medicago sativa GN=MSK-3 PE=2 SV=2
Length = 411

Score = 180 bits (457), Expect = 2e-45
Identities = 89/136 (65%), Positives = 109/136 (80%)
Frame = -1

Query: 410 AGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQK 231
A GV++LP EM +MK+RD++ + E AT + + N TE+G+IIVT + G NGQ K
Sbjct: 17 ASSVGVEKLPEEMNDMKIRDDK------EMEAAT-IVDGNGTETGHIIVTTIGGKNGQPK 69

Query: 230 QVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQMLEHPNIVG 51
Q ISYMAERVVG GSFG+VFQA+C+ETGE VAIKKVLQDKRYKNRELQ M++L+HPN+V
Sbjct: 70 QTISYMAERVVGHGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVS 129

Query: 50 LKHCFYSNTEKDELYL 3
LKHCF+S TEKDELYL
Sbjct: 130 LKHCFFSTTEKDELYL 145


>sp|Q40518|MSK1_TOBAC Shaggy-related protein kinase NtK-1
OS=Nicotiana tabacum GN=NTK-1 PE=2 SV=1
Length = 409

Score = 178 bits (452), Expect = 9e-45
Identities = 86/132 (65%), Positives = 106/132 (80%)
Frame = -1

Query: 398 GVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQKQVIS 219
GVD+LP EM +M++RD DKE A+ + N TE+G+IIVT + G +GQ KQ IS
Sbjct: 21 GVDRLPEEMNDMRIRD--------DKEIEAAIVDGNGTETGHIIVTTIGGRHGQPKQTIS 72

Query: 218 YMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQMLEHPNIVGLKHC 39
YMAER+VG GSFG+VFQA+C+ETGE VAIKKVLQDKRYKNRELQ M++L+HPN+V LKHC
Sbjct: 73 YMAERIVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVCLKHC 132

Query: 38 FYSNTEKDELYL 3
F+S TEKDE+YL
Sbjct: 133 FFSTTEKDEVYL 144


>sp|P43289|KSG3_ARATH Shaggy-related protein kinase gamma
OS=Arabidopsis thaliana GN=ASK3 PE=2 SV=1
Length = 409

Score = 177 bits (450), Expect = 1e-44
Identities = 86/130 (66%), Positives = 103/130 (79%)
Frame = -1

Query: 392 DQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQKQVISYM 213
D+LP EM +MK++D DKE + N N TE+G+IIVT + G NGQ KQ ISYM
Sbjct: 23 DRLPEEMKDMKIQD--------DKEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYM 74

Query: 212 AERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQMLEHPNIVGLKHCFY 33
AERVVG GSFG+VFQA+C+ETGE VAIKKVLQD+RYKNRELQ M++L+HPN+V LKHCF+
Sbjct: 75 AERVVGHGSFGVVFQAKCLETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFF 134

Query: 32 SNTEKDELYL 3
S TEKDELYL
Sbjct: 135 STTEKDELYL 144


>sp|P51138|MSK2_MEDSA Glycogen synthase kinase-3 homolog MsK-2
OS=Medicago sativa GN=MSK-2 PE=2 SV=1
Length = 411

Score = 175 bits (444), Expect = 7e-44
Identities = 85/131 (64%), Positives = 104/131 (79%)
Frame = -1

Query: 395 VDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQKQVISY 216
VD+LP E+L M+++D DKE + + NSTE+G++IVT + G NGQ KQ ISY
Sbjct: 23 VDKLPDEILGMRIKD--------DKEMEAHVVDGNSTEAGHVIVTTIGGKNGQPKQTISY 74

Query: 215 MAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQMLEHPNIVGLKHCF 36
MAER VG GSFG+VFQA+C+ETGE VAIKKVLQDKRYKNRELQ M++L+HPN+V LKHCF
Sbjct: 75 MAERAVGQGSFGVVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHCF 134

Query: 35 YSNTEKDELYL 3
+S TEKDELYL
Sbjct: 135 FSTTEKDELYL 145


>sp|Q8VZD5|KSG5_ARATH Shaggy-related protein kinase epsilon
OS=Arabidopsis thaliana GN=ASK5 PE=2 SV=1
Length = 410

Score = 175 bits (443), Expect = 9e-44
Identities = 85/130 (65%), Positives = 103/130 (79%)
Frame = -1

Query: 392 DQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQKQVISYM 213
++LP + EMK++D DKE A+ + N TE+G+IIVT + G NGQ KQ ISYM
Sbjct: 24 EKLPEGINEMKIKD--------DKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYM 75

Query: 212 AERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQMLEHPNIVGLKHCFY 33
AER+VG GSFGIVFQA+C+ETGE VAIKKVLQDKRYKNRELQ M++L+HPN+V LKHCF+
Sbjct: 76 AERIVGQGSFGIVFQAKCLETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFF 135

Query: 32 SNTEKDELYL 3
S TEKDELYL
Sbjct: 136 STTEKDELYL 145


>sp|Q96287|KSG8_ARATH Shaggy-related protein kinase theta
OS=Arabidopsis thaliana GN=ASK8 PE=2 SV=3
Length = 472

Score = 174 bits (440), Expect = 2e-43
Identities = 89/145 (61%), Positives = 112/145 (77%), Gaps = 2/145 (1%)
Frame = -1

Query: 431 AGSSTVFA--GKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTA 258
AG+S V A K DQLP M+EMK+RD R + + DK+ T + N + TE+G +I T
Sbjct: 66 AGTSNVPAVSEKPVDDQLPDVMIEMKIRDER-NANREDKDMETTVVNGSGTETGQVITTT 124

Query: 257 VAGSNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQ 78
V G +G+ KQ ISYMA+RVVGTGSFG+VFQA+C+ETGE VAIKKVLQDKRYKNRELQIM+
Sbjct: 125 VGGRDGKPKQTISYMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQIMR 184

Query: 77 MLEHPNIVGLKHCFYSNTEKDELYL 3
+ +HPN+V L+H F+S T+KDELYL
Sbjct: 185 LQDHPNVVRLRHSFFSTTDKDELYL 209


>sp|Q9FVS6|KSG4_ARATH Shaggy-related protein kinase delta
OS=Arabidopsis thaliana GN=ASK4 PE=2 SV=1
Length = 420

Score = 164 bits (414), Expect = 2e-40
Identities = 82/131 (62%), Positives = 99/131 (75%)
Frame = -1

Query: 395 VDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQKQVISY 216
VD L R+MLEMK+RD D D E + + E G++I T + G NGQ +Q +SY
Sbjct: 25 VDWLSRDMLEMKIRDKTEADEERDSE--PDIIDGVGAEPGHVITTTLPGRNGQSRQTVSY 82

Query: 215 MAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQMLEHPNIVGLKHCF 36
+AE VVGTGSFG+VFQA+C ETGE+VAIKKVLQDKRYKNRELQIMQML+HPN+V LKH F
Sbjct: 83 IAEHVVGTGSFGMVFQAKCRETGEVVAIKKVLQDKRYKNRELQIMQMLDHPNVVCLKHSF 142

Query: 35 YSNTEKDELYL 3
YS TE +E+YL
Sbjct: 143 YSRTENEEVYL 153


>sp|O04160|KSGT_BRANA Shaggy-related protein kinase theta
OS=Brassica napus PE=2 SV=2
Length = 468

Score = 162 bits (411), Expect = 5e-40
Identities = 79/132 (59%), Positives = 101/132 (76%), Gaps = 2/132 (1%)
Frame = -1

Query: 392 DQLPREMLEMKLRDNR--LDDSGNDKEGATALANSNSTESGNIIVTAVAGSNGQQKQVIS 219
DQLP M +M+LR++ + DK+ + N TE+G +I T V G +G+ KQ IS
Sbjct: 74 DQLPEVMNDMRLREDEPHANRGEEDKDMEPPIVNGCGTETGQVITTTVGGRDGKPKQTIS 133

Query: 218 YMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQMLEHPNIVGLKHC 39
YMA+RVVGTGSFG+VFQA+C+ETGE VAIKKVLQDKRYKNRELQIM++ +HPN+V L+H
Sbjct: 134 YMAQRVVGTGSFGVVFQAKCLETGEQVAIKKVLQDKRYKNRELQIMRLQDHPNVVRLRHS 193

Query: 38 FYSNTEKDELYL 3
F+S T+KDELYL
Sbjct: 194 FFSTTDKDELYL 205


tr_hit_id Q6VM08
Definition tr|Q6VM08|Q6VM08_PHYPA Shaggy-related protein kinase 2 OS=Physcomitrella patens
Align length 144
Score (bit) 199.0
E-value 7.0e-50
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912882|Adiantum capillus-veneris mRNA, clone:
YMU001_000023_H09.
(455 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6VM08|Q6VM08_PHYPA Shaggy-related protein kinase 2 OS=Physco... 199 7e-50
tr|A9SAB0|A9SAB0_PHYPA Predicted protein OS=Physcomitrella paten... 199 7e-50
tr|Q6VM07|Q6VM07_PHYPA Shaggy-related protein kinase 3 OS=Physco... 197 2e-49
tr|A9TSH9|A9TSH9_PHYPA Predicted protein OS=Physcomitrella paten... 197 2e-49
tr|A9SFW7|A9SFW7_PHYPA Predicted protein OS=Physcomitrella paten... 197 3e-49
tr|Q6VM11|Q6VM11_PHYPA Shaggy-related protein kinase 4 OS=Physco... 196 5e-49
tr|A9S6L2|A9S6L2_PHYPA Predicted protein OS=Physcomitrella paten... 196 5e-49
tr|A9TSI8|A9TSI8_PHYPA Predicted protein OS=Physcomitrella paten... 196 6e-49
tr|Q6VM14|Q6VM14_PHYPA Shaggy-related protein kinase 1 OS=Physco... 192 9e-48
tr|Q6VM09|Q6VM09_PHYPA Shaggy-related protein kinase 1 (Fragment... 192 9e-48
tr|A9SAB9|A9SAB9_PHYPA Predicted protein OS=Physcomitrella paten... 192 9e-48
tr|Q9FSG4|Q9FSG4_MEDSA Wound-induced GSK-3-like protein (Fragmen... 186 5e-46
tr|A7PXZ0|A7PXZ0_VITVI Chromosome chr15 scaffold_37, whole genom... 184 2e-45
tr|Q53VM1|Q53VM1_LOTJA Ser/Thr protein kinase OS=Lotus japonicus... 184 2e-45
tr|Q40887|Q40887_PETHY Petunia Shaggy kinase 6 OS=Petunia hybrid... 183 3e-45
tr|O82038|O82038_PETHY Shaggy kinase 6 OS=Petunia hybrida GN=PSK... 183 3e-45
tr|B0FSK1|B0FSK1_9MAGN Serine/threonine protein kinase OS=Adonis... 183 3e-45
tr|A7PRK9|A7PRK9_VITVI Chromosome chr14 scaffold_27, whole genom... 182 6e-45
tr|Q53VM0|Q53VM0_LOTJA Ser/Thr protein kinase OS=Lotus japonicus... 182 7e-45
tr|O24139|O24139_TOBAC Shaggy-like kinase 6 (Nsk6) OS=Nicotiana ... 182 7e-45
tr|A9NV52|A9NV52_PICSI Putative uncharacterized protein OS=Picea... 182 7e-45
tr|O82707|O82707_PETHY Shaggy kinase 7 OS=Petunia hybrida GN=PSK... 182 9e-45
tr|O24130|O24130_TOBAC Shaggy-like kinase 59 OS=Nicotiana tabacu... 182 9e-45
tr|B7FF94|B7FF94_MEDTR Putative uncharacterized protein OS=Medic... 182 9e-45
tr|Q2VCJ3|Q2VCJ3_SOLTU NtK-1-like OS=Solanum tuberosum PE=2 SV=1 181 2e-44
tr|O82029|O82029_TOBAC Shaggy-like kinase 91 OS=Nicotiana tabacu... 181 2e-44
tr|A5AGP7|A5AGP7_VITVI Putative uncharacterized protein (Chromos... 180 4e-44
tr|Q8LNI5|Q8LNI5_ORYSJ Os10g0521700 protein OS=Oryza sativa subs... 179 5e-44
tr|O24129|O24129_TOBAC Shaggy-like kinase 111 OS=Nicotiana tabac... 179 5e-44
tr|B8BHX5|B8BHX5_ORYSI Putative uncharacterized protein OS=Oryza... 179 5e-44

>tr|Q6VM08|Q6VM08_PHYPA Shaggy-related protein kinase 2
OS=Physcomitrella patens GN=SK2 PE=2 SV=1
Length = 423

Score = 199 bits (505), Expect = 7e-50
Identities = 96/144 (66%), Positives = 119/144 (82%)
Frame = -1

Query: 434 GAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAV 255
G G++ + AG GV+ LP+EM +MKLRD+++D S +DKE ++ + N TE+G+II T +
Sbjct: 16 GGGTAPIKAGSSGVESLPKEMHDMKLRDDKVDHS-DDKEIEASVVDGNGTETGHIIATTI 74

Query: 254 AGSNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQM 75
G NGQ KQ ISY AERVVGTGSFGIVFQA+CIETGE VAIKKVLQDKRYKNRELQIM++
Sbjct: 75 GGKNGQPKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRL 134

Query: 74 LEHPNIVGLKHCFYSNTEKDELYL 3
L+HPNIV LKHCF+S T+KDEL+L
Sbjct: 135 LDHPNIVALKHCFFSTTDKDELFL 158


>tr|A9SAB0|A9SAB0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_163779 PE=4 SV=1
Length = 423

Score = 199 bits (505), Expect = 7e-50
Identities = 96/144 (66%), Positives = 119/144 (82%)
Frame = -1

Query: 434 GAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAV 255
G G++ + AG GV+ LP+EM +MKLRD+++D S +DKE ++ + N TE+G+II T +
Sbjct: 16 GGGTAPIKAGSSGVESLPKEMHDMKLRDDKVDHS-DDKEIEASVVDGNGTETGHIIATTI 74

Query: 254 AGSNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQM 75
G NGQ KQ ISY AERVVGTGSFGIVFQA+CIETGE VAIKKVLQDKRYKNRELQIM++
Sbjct: 75 GGKNGQPKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRL 134

Query: 74 LEHPNIVGLKHCFYSNTEKDELYL 3
L+HPNIV LKHCF+S T+KDEL+L
Sbjct: 135 LDHPNIVALKHCFFSTTDKDELFL 158


>tr|Q6VM07|Q6VM07_PHYPA Shaggy-related protein kinase 3
OS=Physcomitrella patens GN=SK3 PE=2 SV=1
Length = 423

Score = 197 bits (501), Expect = 2e-49
Identities = 97/144 (67%), Positives = 117/144 (81%)
Frame = -1

Query: 434 GAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAV 255
G G + AG GV+ LP+EM +MKLRD+++D S +DKE ++ + N TE+G+II T +
Sbjct: 16 GGGIAPTKAGSSGVELLPKEMHDMKLRDDKVDHS-DDKEIEASIVDGNGTETGHIIATTI 74

Query: 254 AGSNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQM 75
G NGQ KQ ISY AERVVGTGSFGIVFQA+CIETGE VAIKKVLQDKRYKNRELQIM++
Sbjct: 75 GGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRL 134

Query: 74 LEHPNIVGLKHCFYSNTEKDELYL 3
L+HPNIV LKHCF+S T+KDELYL
Sbjct: 135 LDHPNIVALKHCFFSTTDKDELYL 158


>tr|A9TSH9|A9TSH9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_197781 PE=4 SV=1
Length = 424

Score = 197 bits (501), Expect = 2e-49
Identities = 97/144 (67%), Positives = 117/144 (81%)
Frame = -1

Query: 434 GAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAV 255
G G + AG GV+ LP+EM +MKLRD+++D S +DKE ++ + N TE+G+II T +
Sbjct: 16 GGGIAPTKAGSSGVELLPKEMHDMKLRDDKVDHS-DDKEIEASIVDGNGTETGHIIATTI 74

Query: 254 AGSNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQM 75
G NGQ KQ ISY AERVVGTGSFGIVFQA+CIETGE VAIKKVLQDKRYKNRELQIM++
Sbjct: 75 GGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRL 134

Query: 74 LEHPNIVGLKHCFYSNTEKDELYL 3
L+HPNIV LKHCF+S T+KDELYL
Sbjct: 135 LDHPNIVALKHCFFSTTDKDELYL 158


>tr|A9SFW7|A9SFW7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_211896 PE=4 SV=1
Length = 424

Score = 197 bits (500), Expect = 3e-49
Identities = 98/144 (68%), Positives = 115/144 (79%)
Frame = -1

Query: 434 GAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAV 255
G G+ AG GV+ LP+EM MKLRD+++D S +DKE + + N TE+G+II T +
Sbjct: 17 GGGAVPTKAGSSGVESLPKEMHGMKLRDDKVDHS-DDKEFEATVVDGNGTETGHIIATTI 75

Query: 254 AGSNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQM 75
G NGQ KQ ISY AERVVGTGSFGIVFQA+CIE+GE VAIKKVLQDKRYKNRELQIM++
Sbjct: 76 GGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRL 135

Query: 74 LEHPNIVGLKHCFYSNTEKDELYL 3
LEHPNIV LKHCF+S TEKDELYL
Sbjct: 136 LEHPNIVALKHCFFSTTEKDELYL 159


>tr|Q6VM11|Q6VM11_PHYPA Shaggy-related protein kinase 4
OS=Physcomitrella patens GN=SK4 PE=2 SV=1
Length = 424

Score = 196 bits (498), Expect = 5e-49
Identities = 97/144 (67%), Positives = 116/144 (80%)
Frame = -1

Query: 434 GAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAV 255
G ++ AG GV+ LP+EM EMKLRD+++D G+DKE + + N TE+G+II T +
Sbjct: 17 GGRAAPTKAGSSGVELLPKEMHEMKLRDDKVDH-GDDKEIEATVVDGNGTETGHIIATTI 75

Query: 254 AGSNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQM 75
G NGQ KQ ISY AERVVGTGSFGIVFQA+CIE+GE VAIKKVLQDKRYKNRELQIM++
Sbjct: 76 GGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRL 135

Query: 74 LEHPNIVGLKHCFYSNTEKDELYL 3
L+HPNIV LKHCF+S TEKDELYL
Sbjct: 136 LDHPNIVALKHCFFSTTEKDELYL 159


>tr|A9S6L2|A9S6L2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_105861 PE=4 SV=1
Length = 424

Score = 196 bits (498), Expect = 5e-49
Identities = 97/144 (67%), Positives = 116/144 (80%)
Frame = -1

Query: 434 GAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAV 255
G ++ AG GV+ LP+EM EMKLRD+++D G+DKE + + N TE+G+II T +
Sbjct: 17 GGRAAPTKAGSSGVELLPKEMHEMKLRDDKVDH-GDDKEIEATVVDGNGTETGHIIATTI 75

Query: 254 AGSNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQM 75
G NGQ KQ ISY AERVVGTGSFGIVFQA+CIE+GE VAIKKVLQDKRYKNRELQIM++
Sbjct: 76 GGRNGQPKQTISYSAERVVGTGSFGIVFQAKCIESGETVAIKKVLQDKRYKNRELQIMRL 135

Query: 74 LEHPNIVGLKHCFYSNTEKDELYL 3
L+HPNIV LKHCF+S TEKDELYL
Sbjct: 136 LDHPNIVALKHCFFSTTEKDELYL 159


>tr|A9TSI8|A9TSI8_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_197793 PE=4 SV=1
Length = 424

Score = 196 bits (497), Expect = 6e-49
Identities = 96/144 (66%), Positives = 116/144 (80%)
Frame = -1

Query: 434 GAGSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAV 255
G G++ G GV+ LP+EM MKLRD+++D S +DKE ++ + N TE+G+II T +
Sbjct: 16 GGGAAPTKPGSSGVESLPKEMHGMKLRDDKVDHS-DDKEIEASVVDGNGTETGHIIATTI 74

Query: 254 AGSNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQM 75
G NGQ KQ ISY AERVVGTGSFGIVFQA+CIETGE VAIKKVLQDKRYKNRELQIM++
Sbjct: 75 GGKNGQPKQTISYSAERVVGTGSFGIVFQAKCIETGETVAIKKVLQDKRYKNRELQIMRL 134

Query: 74 LEHPNIVGLKHCFYSNTEKDELYL 3
L+HPNIV LKHCF+S T+KDELYL
Sbjct: 135 LDHPNIVALKHCFFSTTDKDELYL 158


>tr|Q6VM14|Q6VM14_PHYPA Shaggy-related protein kinase 1
OS=Physcomitrella patens GN=SK1 PE=2 SV=1
Length = 422

Score = 192 bits (487), Expect = 9e-48
Identities = 94/142 (66%), Positives = 113/142 (79%)
Frame = -1

Query: 428 GSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAG 249
G + + AG GV+ LP+EM +MKLRD ++D S +DKE ++ N TE+G+II T + G
Sbjct: 17 GGAPIKAGSSGVESLPKEMHDMKLRDEKVDHS-DDKEIEASVVAGNGTETGHIIATTIGG 75

Query: 248 SNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQMLE 69
NGQ KQ ISY AERVVGTGSFGIVFQA+CIET E VAIKKVLQDKRYKNRELQIM++ +
Sbjct: 76 RNGQPKQTISYCAERVVGTGSFGIVFQAKCIETAETVAIKKVLQDKRYKNRELQIMRLFD 135

Query: 68 HPNIVGLKHCFYSNTEKDELYL 3
HPNIV LKHCF+S T+KDELYL
Sbjct: 136 HPNIVALKHCFFSTTDKDELYL 157


>tr|Q6VM09|Q6VM09_PHYPA Shaggy-related protein kinase 1 (Fragment)
OS=Physcomitrella patens GN=SK1 PE=4 SV=1
Length = 410

Score = 192 bits (487), Expect = 9e-48
Identities = 94/142 (66%), Positives = 113/142 (79%)
Frame = -1

Query: 428 GSSTVFAGKGGVDQLPREMLEMKLRDNRLDDSGNDKEGATALANSNSTESGNIIVTAVAG 249
G + + AG GV+ LP+EM +MKLRD ++D S +DKE ++ N TE+G+II T + G
Sbjct: 5 GGAPIKAGSSGVESLPKEMHDMKLRDEKVDHS-DDKEIEASVVAGNGTETGHIIATTIGG 63

Query: 248 SNGQQKQVISYMAERVVGTGSFGIVFQARCIETGEMVAIKKVLQDKRYKNRELQIMQMLE 69
NGQ KQ ISY AERVVGTGSFGIVFQA+CIET E VAIKKVLQDKRYKNRELQIM++ +
Sbjct: 64 RNGQPKQTISYCAERVVGTGSFGIVFQAKCIETAETVAIKKVLQDKRYKNRELQIMRLFD 123

Query: 68 HPNIVGLKHCFYSNTEKDELYL 3
HPNIV LKHCF+S T+KDELYL
Sbjct: 124 HPNIVALKHCFFSTTDKDELYL 145