BP912909
Clone id YMU001_000024_C02
Library
Length 581
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000024_C02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
AACTGGCTTTTGTGAAATTTGACTAGAGCCCATCTTCTGTTCCTCGTGATCTACAACTGG
AACAATCTTTTCAACAGATGTTAAAACTTGGCCAGGTCGCCTCCTTCGCCTTTTCCAGTC
GTCCTCTAGCAAAGAATCACGAAATCGGGACGGTAAAGCTTGGGCTCTGCCTCGTCTACT
ACGAATTAAAGGAGCCTTCACTCTTTCTGGAGACATTGCAGCAATTCTTTTCAGAGTTTC
AATATCATACTCCTCTGCATCATCTTCCTTTTCTTTTGGAGAACCTGGACGTGAGGTCTG
CTCCGCCCCACTATTTTCATTTGTGGAATCTGAATCTTCCTCTGTGAACAGCATCCCTGC
CTCCCCTTGGAAACCATCAGAACTGTAACTCCCTCTTTCAAGAAGCTCAAGTTCAGAGCT
TCTCAGCTCAGCCTCGAGACCTGAGGCTGCCTGCACAAGAAGGTCTAAAGAAGATAACTT
CTCCACTTTCTTTTGAGAATTGAGCATATCATATGCCCTATCCTTGCTCCCGCTGTAAAG
GGTTCTCTCTTGGTTTTGCCCATGCTTCTCTCTCTTGGAAG
■■Homology search results ■■ -
sp_hit_id Q8GZ42
Definition sp|Q8GZ42|ATX5_ARATH Histone-lysine N-methyltransferase ATX5 OS=Arabidopsis thaliana
Align length 67
Score (bit) 44.3
E-value 0.0004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912909|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_C02.
(581 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q8GZ42|ATX5_ARATH Histone-lysine N-methyltransferase ATX5 OS=... 44 4e-04
sp|Q9SUE7|ATX4_ARATH Histone-lysine N-methyltransferase ATX4 OS=... 40 0.011
sp|Q91616|NDF1_XENLA Neurogenic differentiation factor 1 OS=Xeno... 38 0.032
sp|Q505H7|IWS1_XENTR Protein IWS1 homolog OS=Xenopus tropicalis ... 35 0.35
sp|Q6DE96|IWS1A_XENLA Protein IWS1 homolog A OS=Xenopus laevis G... 35 0.35
sp|A8R4Q8|PC4L1_BOVIN Purkinje cell protein 4-like protein 1 OS=... 34 0.46
sp|Q9M364|ATX3_ARATH Histone-lysine N-methyltransferase ATX3 OS=... 34 0.60
sp|Q9W596|FUTSC_DROME Microtubule-associated protein futsch OS=D... 33 0.79
sp|Q4IQW0|NOP12_GIBZE Nucleolar protein 12 OS=Gibberella zeae GN... 33 1.0
sp|Q9ZVM9|Y1461_ARATH Putative serine/threonine-protein kinase A... 33 1.3
sp|Q9Y520|BA2D1_HUMAN BAT2 domain-containing protein 1 OS=Homo s... 33 1.3
sp|Q8TG40|KAD6_CANAL Putative adenylate kinase HBR1 OS=Candida a... 32 1.8
sp|Q1LUE5|ZCH18_DANRE Zinc finger CCCH domain-containing protein... 32 2.3
sp|P13259|PCY1_YEAST Choline-phosphate cytidylyltransferase OS=S... 32 2.3
sp|P92969|RPOT1_ARATH DNA-directed RNA polymerase 1, mitochondri... 32 3.0
sp|Q5L0E5|MUTS_GEOKA DNA mismatch repair protein mutS OS=Geobaci... 32 3.0
sp|Q2GA15|ENGA_NOVAD GTP-binding protein engA OS=Novosphingobium... 32 3.0
sp|Q9WV30|NFAT5_MOUSE Nuclear factor of activated T-cells 5 OS=M... 31 3.9
sp|O94916|NFAT5_HUMAN Nuclear factor of activated T-cells 5 OS=H... 31 3.9
sp|Q17336|NCM_CAEEL Nucampholin OS=Caenorhabditis elegans GN=let... 31 5.1
sp|Q6P5Q4|LMOD2_HUMAN Leiomodin-2 OS=Homo sapiens GN=LMOD2 PE=2 ... 31 5.1
sp|Q8A8C4|GRPE_BACTN Protein grpE OS=Bacteroides thetaiotaomicro... 31 5.1
sp|P47110|DPOD3_YEAST DNA polymerase delta subunit 3 OS=Saccharo... 31 5.1
sp|Q5ZMN0|AN32B_CHICK Acidic leucine-rich nuclear phosphoprotein... 31 5.1
sp|Q05672|RBS1_YEAST RNA-binding suppressor of PAS kinase protei... 30 6.7
sp|Q4R381|EZH2_MACFA Histone-lysine N-methyltransferase EZH2 OS=... 30 6.7
sp|Q15910|EZH2_HUMAN Histone-lysine N-methyltransferase EZH2 OS=... 30 6.7
sp|Q8C1R3|CQ050_MOUSE Uncharacterized protein C17orf50 homolog O... 30 6.7
sp|Q54KF2|Y7452_DICDI Putative uncharacterized protein DDB_G0287... 30 8.7
sp|Q62361|TRH_MOUSE Prothyroliberin OS=Mus musculus GN=Trh PE=2 ... 30 8.7

>sp|Q8GZ42|ATX5_ARATH Histone-lysine N-methyltransferase ATX5
OS=Arabidopsis thaliana GN=ATX5 PE=2 SV=1
Length = 1043

Score = 44.3 bits (103), Expect = 4e-04
Identities = 23/67 (34%), Positives = 43/67 (64%), Gaps = 2/67 (2%)
Frame = -3

Query: 282 SPKEK--EDDAEEYDIETLKRIAAMSPERVKAPLIRSRRGRAQALPSRFRDSLLEDDWKR 109
SPK + E++ EE +I++ + ++ + PL+++ RGR Q LPSRF DS++E +W++
Sbjct: 72 SPKVEVVEEEEEEEEIKSTRLVS-------RPPLVKTSRGRVQVLPSRFNDSVIE-NWRK 123

Query: 108 RRRRPGQ 88
+ G+
Sbjct: 124 DNKSSGE 130


>sp|Q9SUE7|ATX4_ARATH Histone-lysine N-methyltransferase ATX4
OS=Arabidopsis thaliana GN=ATX4 PE=2 SV=2
Length = 990

Score = 39.7 bits (91), Expect = 0.011
Identities = 17/30 (56%), Positives = 24/30 (80%)
Frame = -3

Query: 198 KAPLIRSRRGRAQALPSRFRDSLLEDDWKR 109
+ PL+R+ RGR Q LPSRF DS+L D+W++
Sbjct: 98 RPPLVRTSRGRIQVLPSRFNDSVL-DNWRK 126


>sp|Q91616|NDF1_XENLA Neurogenic differentiation factor 1 OS=Xenopus
laevis GN=neurod1 PE=2 SV=1
Length = 352

Score = 38.1 bits (87), Expect = 0.032
Identities = 26/100 (26%), Positives = 45/100 (45%)
Frame = -3

Query: 357 GMLFTEEDSDSTNENSGAEQTSRPGSPKEKEDDAEEYDIETLKRIAAMSPERVKAPLIRS 178
G L E+D DS N ++G E +E+EDD E+ D + ++ P++ K R
Sbjct: 39 GELMKEDDEDSLNHHNGEENEEEDEGDEEEEDD-EDDDEDDDQKPKRRGPKKKKMTKARV 97

Query: 177 RRGRAQALPSRFRDSLLEDDWKRRRRRPGQVLTSVEKIVP 58
R + + + + R+ + R L S+ K+VP
Sbjct: 98 ERFKVRRMKANARE-------RNRMHGLNDALDSLRKVVP 130


>sp|Q505H7|IWS1_XENTR Protein IWS1 homolog OS=Xenopus tropicalis
GN=iws1 PE=2 SV=1
Length = 909

Score = 34.7 bits (78), Expect = 0.35
Identities = 21/50 (42%), Positives = 27/50 (54%)
Frame = -3

Query: 378 DGFQGEAGMLFTEEDSDSTNENSGAEQTSRPGSPKEKEDDAEEYDIETLK 229
D G A + E DS S +E + EQ S PGSP+ + +D E DIE K
Sbjct: 12 DADDGGATPVQDERDSASDDEGNEREQRSEPGSPERQSED-EHSDIEDNK 60


>sp|Q6DE96|IWS1A_XENLA Protein IWS1 homolog A OS=Xenopus laevis
GN=iws1-A PE=2 SV=1
Length = 836

Score = 34.7 bits (78), Expect = 0.35
Identities = 16/45 (35%), Positives = 27/45 (60%)
Frame = -3

Query: 363 EAGMLFTEEDSDSTNENSGAEQTSRPGSPKEKEDDAEEYDIETLK 229
+ G +++ DS +++ G EQ S PGSP+ + +D E D+E K
Sbjct: 13 DGGATPVQDERDSASDDEGNEQRSEPGSPEHQSED-EHSDVEDHK 56


>sp|A8R4Q8|PC4L1_BOVIN Purkinje cell protein 4-like protein 1 OS=Bos
taurus GN=PCP4L1 PE=3 SV=1
Length = 69

Score = 34.3 bits (77), Expect = 0.46
Identities = 22/66 (33%), Positives = 35/66 (53%)
Frame = -3

Query: 333 SDSTNENSGAEQTSRPGSPKEKEDDAEEYDIETLKRIAAMSPERVKAPLIRSRRGRAQAL 154
S +TN+ G E+ + GS K+ ED+ EE DI+ +PE KA L + +G+ +
Sbjct: 9 SPATNQAPGPEEKGKAGSAKKTEDEEEEIDID------LTAPETEKAAL--AIQGKFRRF 60

Query: 153 PSRFRD 136
R +D
Sbjct: 61 QKRKKD 66


>sp|Q9M364|ATX3_ARATH Histone-lysine N-methyltransferase ATX3
OS=Arabidopsis thaliana GN=ATX3 PE=2 SV=1
Length = 902

Score = 33.9 bits (76), Expect = 0.60
Identities = 15/29 (51%), Positives = 22/29 (75%)
Frame = -3

Query: 183 RSRRGRAQALPSRFRDSLLEDDWKRRRRR 97
+S RGR +A+PSRF+DS++ WK RR+
Sbjct: 77 KSSRGRVRAVPSRFKDSIV-GTWKSSRRK 104


>sp|Q9W596|FUTSC_DROME Microtubule-associated protein futsch
OS=Drosophila melanogaster GN=futsch PE=1 SV=3
Length = 5412

Score = 33.5 bits (75), Expect = 0.79
Identities = 28/101 (27%), Positives = 48/101 (47%)
Frame = -3

Query: 306 AEQTSRPGSPKEKEDDAEEYDIETLKRIAAMSPERVKAPLIRSRRGRAQALPSRFRDSLL 127
++ TSRPGS E +E + +R + E VKA + + + + PS + L
Sbjct: 2988 SKDTSRPGSMVESVTAEDEKSEQQSRRESVA--ESVKADTKKDGKSQEASRPSSVDELLK 3045

Query: 126 EDDWKRRRRRPGQVLTSVEKIVPVVDHEEQKMGSSQISQKP 4
+DD K+ RR Q +T K + + +E M + S++P
Sbjct: 3046 DDDEKQESRR--QSITGSHKAMSTMG-DESPMDKADKSKEP 3083


>sp|Q4IQW0|NOP12_GIBZE Nucleolar protein 12 OS=Gibberella zeae
GN=NOP12 PE=3 SV=1
Length = 559

Score = 33.1 bits (74), Expect = 1.0
Identities = 29/113 (25%), Positives = 47/113 (41%), Gaps = 5/113 (4%)
Frame = -3

Query: 363 EAGMLFTEEDSDSTNENSGAEQTSRPGSPKEKEDDAEEYDIET---LKRIAAMSPERVKA 193
E G +ED D ENS E S +E+ +D +E + L I + ++
Sbjct: 74 EDGPSDEDEDEDEDEENSEQEDGSGDEQEEEESEDVDETMKDAPVELDDIIDATEDKSNK 133

Query: 192 PLIRSRRGRAQALPSRFRDSLLEDDWKRR--RRRPGQVLTSVEKIVPVVDHEE 40
R R+ L ++ D + ++ R +R+ LT EK P VD E+
Sbjct: 134 ERKRKRKNDNDDLEGKYLDKVAAEEEADRAGKRQKNDALTKTEK--PAVDEED 184


>sp|Q9ZVM9|Y1461_ARATH Putative serine/threonine-protein kinase
At1g54610 OS=Arabidopsis thaliana GN=At1g54610 PE=1 SV=1
Length = 572

Score = 32.7 bits (73), Expect = 1.3
Identities = 24/74 (32%), Positives = 35/74 (47%)
Frame = -3

Query: 324 TNENSGAEQTSRPGSPKEKEDDAEEYDIETLKRIAAMSPERVKAPLIRSRRGRAQALPSR 145
T+E E P P KE DA+ D ET ++ AA + A R R +ALP+
Sbjct: 403 TSEPYACEPADLPKYPPSKEIDAKRRDEETRRQRAASKAQGDGARKNRHRDRSNRALPAP 462

Query: 144 FRDSLLEDDWKRRR 103
++ L+ + RRR
Sbjct: 463 EANAELQSNVDRRR 476


tr_hit_id B8A6V0
Definition tr|B8A6V0|B8A6V0_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 69
Score (bit) 50.8
E-value 5.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912909|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_C02.
(581 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8A6V0|B8A6V0_ORYSI Putative uncharacterized protein OS=Oryza... 51 5e-05
tr|A2ZW50|A2ZW50_ORYSJ Putative uncharacterized protein OS=Oryza... 51 5e-05
tr|A7QEQ4|A7QEQ4_VITVI Chromosome chr16 scaffold_86, whole genom... 41 0.055
tr|A7PZX4|A7PZX4_VITVI Chromosome chr15 scaffold_40, whole genom... 40 0.072
tr|B8LRP7|B8LRP7_PICSI Putative uncharacterized protein OS=Picea... 37 0.61
tr|O17909|O17909_CAEEL Protein H06O01.2, partially confirmed by ... 37 0.61
tr|Q7XTQ1|Q7XTQ1_ORYSJ OSJNBa0041A02.23 protein OS=Oryza sativa ... 37 0.80
tr|Q291T1|Q291T1_DROPS GA20745 OS=Drosophila pseudoobscura pseud... 37 0.80
tr|B4GAB6|B4GAB6_DROPE GL11347 OS=Drosophila persimilis GN=GL113... 37 0.80
tr|Q5KDK5|Q5KDK5_CRYNE Protein binding protein, putative OS=Cryp... 37 0.80
tr|B0CWY0|B0CWY0_LACBS Predicted protein OS=Laccaria bicolor (st... 37 1.0
tr|B5L6E5|B5L6E5_9PROT RpoD (Fragment) OS=Thalassospira sp. MCCC... 36 1.4
tr|B5L6E3|B5L6E3_9PROT RpoD (Fragment) OS=Thalassospira sp. MCCC... 36 1.4
tr|Q5PY68|Q5PY68_TOXGO Nucleolar protein (Fragment) OS=Toxoplasm... 36 1.4
tr|B6KL12|B6KL12_TOXGO Nucleolar phosphoprotein nucleolin, putat... 36 1.4
tr|B4JSH4|B4JSH4_DROGR GH18063 OS=Drosophila grimshawi GN=GH1806... 36 1.4
tr|Q4JF54|Q4JF54_XENTR NeuroD1 OS=Xenopus tropicalis GN=neurod1 ... 36 1.8
tr|Q01KK6|Q01KK6_ORYSA OSIGBa0118P15.5 protein OS=Oryza sativa G... 35 2.3
tr|Q54EF8|Q54EF8_DICDI Gelsolin-related protein OS=Dictyostelium... 35 2.3
tr|B5L6C9|B5L6C9_9PROT RpoD (Fragment) OS=Thalassospira sp. MCCC... 35 3.0
tr|B5L6C8|B5L6C8_9PROT RpoD (Fragment) OS=Thalassospira sp. MCCC... 35 3.0
tr|Q8GW87|Q8GW87_ARATH Putative uncharacterized protein At2g4002... 35 3.0
tr|O04205|O04205_ARATH Expressed protein (Putative uncharacteriz... 35 3.0
tr|A8MQW8|A8MQW8_ARATH Uncharacterized protein At2g40020.3 OS=Ar... 35 3.0
tr|A8IF44|A8IF44_CHLRE Flagellar associated protein OS=Chlamydom... 35 3.0
tr|Q8HZW3|Q8HZW3_CANFA Heavy neurofilament protein OS=Canis fami... 35 3.0
tr|B4PHP7|B4PHP7_DROYA GE20647 OS=Drosophila yakuba GN=GE20647 P... 35 3.0
tr|Q9VZI0|Q9VZI0_DROME CG14998, isoform B OS=Drosophila melanoga... 35 4.0
tr|Q9I7T2|Q9I7T2_DROME CG14998, isoform A OS=Drosophila melanoga... 35 4.0
tr|Q8IRC1|Q8IRC1_DROME CG14998, isoform C OS=Drosophila melanoga... 35 4.0

>tr|B8A6V0|B8A6V0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03117 PE=4 SV=1
Length = 1012

Score = 50.8 bits (120), Expect = 5e-05
Identities = 26/69 (37%), Positives = 38/69 (55%)
Frame = -3

Query: 264 DDAEEYDIETLKRIAAMSPERVKAPLIRSRRGRAQALPSRFRDSLLEDDWKRRRRRPGQV 85
++AE R AA + + P++R+ RGRAQ LPSRF DS+L D WK+ + V
Sbjct: 70 EEAEVASPAAASRAAAAAAAASRPPVVRTSRGRAQVLPSRFNDSVLIDPWKKDKPAKPPV 129

Query: 84 LTSVEKIVP 58
++VP
Sbjct: 130 PAKAVQLVP 138


>tr|A2ZW50|A2ZW50_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_002772 PE=4 SV=1
Length = 973

Score = 50.8 bits (120), Expect = 5e-05
Identities = 26/69 (37%), Positives = 38/69 (55%)
Frame = -3

Query: 264 DDAEEYDIETLKRIAAMSPERVKAPLIRSRRGRAQALPSRFRDSLLEDDWKRRRRRPGQV 85
++AE R AA + + P++R+ RGRAQ LPSRF DS+L D WK+ + V
Sbjct: 70 EEAEVASPAAASRAAAAAAAASRPPVVRTSRGRAQVLPSRFNDSVLIDPWKKDKPAKPPV 129

Query: 84 LTSVEKIVP 58
++VP
Sbjct: 130 PAKAVQLVP 138


>tr|A7QEQ4|A7QEQ4_VITVI Chromosome chr16 scaffold_86, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00037113001
PE=4 SV=1
Length = 1041

Score = 40.8 bits (94), Expect = 0.055
Identities = 17/33 (51%), Positives = 25/33 (75%)
Frame = -3

Query: 198 KAPLIRSRRGRAQALPSRFRDSLLEDDWKRRRR 100
+ PL+R+ RGR Q LPSRF DS+L D+W++ +
Sbjct: 98 RPPLVRTSRGRVQVLPSRFNDSIL-DNWRKESK 129


>tr|A7PZX4|A7PZX4_VITVI Chromosome chr15 scaffold_40, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00027049001
PE=4 SV=1
Length = 1038

Score = 40.4 bits (93), Expect = 0.072
Identities = 21/63 (33%), Positives = 40/63 (63%)
Frame = -3

Query: 207 ERVKAPLIRSRRGRAQALPSRFRDSLLEDDWKRRRRRPGQVLTSVEKIVPVVDHEEQKMG 28
E + PL+ S RGR +ALPSRF DS++ D W + + + ++++ VV +E++++G
Sbjct: 76 EGSRPPLLPSSRGRHRALPSRFNDSII-DSWTKEDSKADDMESNLDDF-EVVVYEKERIG 133

Query: 27 SSQ 19
+ +
Sbjct: 134 TGR 136


>tr|B8LRP7|B8LRP7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 202

Score = 37.4 bits (85), Expect = 0.61
Identities = 21/74 (28%), Positives = 37/74 (50%)
Frame = -3

Query: 318 ENSGAEQTSRPGSPKEKEDDAEEYDIETLKRIAAMSPERVKAPLIRSRRGRAQALPSRFR 139
E+ G E ++ K + E+ + ++ + + P RS+RGR QA PS++
Sbjct: 113 EDHGLESANKLAFSKVSQSVDGEHSFNNISKVGEIEQGTMPGP--RSKRGRLQAFPSKYS 170

Query: 138 DSLLEDDWKRRRRR 97
DS L+ WK+ R+
Sbjct: 171 DSELQ-PWKKVSRK 183


>tr|O17909|O17909_CAEEL Protein H06O01.2, partially confirmed by
transcript evidence OS=Caenorhabditis elegans
GN=H06O01.2 PE=2 SV=2
Length = 1461

Score = 37.4 bits (85), Expect = 0.61
Identities = 31/106 (29%), Positives = 46/106 (43%), Gaps = 4/106 (3%)
Frame = -3

Query: 339 EDSDSTNENSGAEQTSRPGSPKEKEDDAEEYDIETLKRIAAMSPERVKAPLIRSRRGRAQ 160
+DSD +ENS + + P +PK+K ++ D ET K + E RS+R
Sbjct: 56 DDSDDASENSSSSEPDEP-APKKKNNNNRGMDAETRK---LLENENYFRRSKRSKRQDDS 111

Query: 159 ALPSRFRDSLLEDDW----KRRRRRPGQVLTSVEKIVPVVDHEEQK 34
+ EDDW K RR +V+ +K V VV + K
Sbjct: 112 PSDNSEESQSSEDDWDDRRKPRRTVTKKVVKQTKKAVSVVKRKSVK 157


>tr|Q7XTQ1|Q7XTQ1_ORYSJ OSJNBa0041A02.23 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0041A02.23 PE=4 SV=2
Length = 1373

Score = 37.0 bits (84), Expect = 0.80
Identities = 17/31 (54%), Positives = 20/31 (64%)
Frame = -3

Query: 342 EEDSDSTNENSGAEQTSRPGSPKEKEDDAEE 250
EE+S S EN E + PGSP +KEDD EE
Sbjct: 441 EEESGSPEENQEGEYQTAPGSPAKKEDDNEE 471


>tr|Q291T1|Q291T1_DROPS GA20745 OS=Drosophila pseudoobscura
pseudoobscura GN=GA20745 PE=4 SV=1
Length = 501

Score = 37.0 bits (84), Expect = 0.80
Identities = 26/107 (24%), Positives = 51/107 (47%), Gaps = 5/107 (4%)
Frame = -3

Query: 339 EDSDSTNENSGAEQTSRPGSPKEKEDDAEEYDIETLKRIAAMSPERVKAPLIRSRRGRA- 163
+D D+ + + AEQ+S + D ++ + +KR P R PL R+ ++
Sbjct: 76 DDEDTADGKNDAEQSSSKRKAAWTDSDDDDIQLGDVKR-----PTRYTGPLTHLRKDKSY 130

Query: 162 -QALPSRFRDSLLEDDWKRRRRRPGQVLTSVE---KIVPVVDHEEQK 34
+ L +RF+ +L + W +++ +S E K V +DH+ +K
Sbjct: 131 KEYLTARFQHTLNQPKWAEKQQNEDSGSSSDEELLKTVGFIDHKAKK 177


>tr|B4GAB6|B4GAB6_DROPE GL11347 OS=Drosophila persimilis GN=GL11347
PE=4 SV=1
Length = 501

Score = 37.0 bits (84), Expect = 0.80
Identities = 26/107 (24%), Positives = 51/107 (47%), Gaps = 5/107 (4%)
Frame = -3

Query: 339 EDSDSTNENSGAEQTSRPGSPKEKEDDAEEYDIETLKRIAAMSPERVKAPLIRSRRGRA- 163
+D D+ + + AEQ+S + D ++ + +KR P R PL R+ ++
Sbjct: 76 DDEDAADGKNDAEQSSSKRKAAWTDSDDDDIQLGDVKR-----PTRYTGPLTHLRKDKSY 130

Query: 162 -QALPSRFRDSLLEDDWKRRRRRPGQVLTSVE---KIVPVVDHEEQK 34
+ L +RF+ +L + W +++ +S E K V +DH+ +K
Sbjct: 131 KEYLTARFQHTLNQPKWAEKQQNEDSGSSSDEELLKTVGFIDHKAKK 177


>tr|Q5KDK5|Q5KDK5_CRYNE Protein binding protein, putative
OS=Cryptococcus neoformans GN=CNG03630 PE=4 SV=1
Length = 1978

Score = 37.0 bits (84), Expect = 0.80
Identities = 18/51 (35%), Positives = 25/51 (49%)
Frame = -3

Query: 366 GEAGMLFTEEDSDSTNENSGAEQTSRPGSPKEKEDDAEEYDIETLKRIAAM 214
GE ML ++ + E G EQ +P E EDD E+D T R+ A+
Sbjct: 1120 GETSMLEPPQEEEEEKEQHGYEQIEKPRVQIEGEDDLNEFDFATTIRVRAL 1170