BP912940
Clone id YMU001_000024_E12
Library
Length 519
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000024_E12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGTCGATTTTCCCACACTTCTGTTTGCACTTGGTGCTGAAACCTGCAATAGGGATGATCC
AAGTTGCAAGAAAAACAGCTGTTGCGATGAGAGACAACAGATGGGGCATTGGCATGGTGA
CAAGTTCCAAGATGAATGAAGTACAAGGAACTTGCAGAGTTTACATGCGGTTGATCGATT
GAGAGCTATACTGGATGTAGGCAGCTGCTCTGTCCAGGATGCACACTCGCTTGTCTGAAT
TGAGCACCTGTTTGAGTGTGTTCTTACACTAGTTGATGCGGCATAGCCATGATCACAAGC
TCCAGGATCGAATGAGGCATAAGCACTTGCGGTATACACAAGTAGTCGCCTGCTGATAGC
TTTCCAGTACAATGAGGATTGCACTGTCTTAGTAGACCATCTTTGTTGAGCCTGTGACAA
TCTCGCAGGAAGGGCGATTGTAGATGATAATCATCTTGCTGTGCAGATGAAGCCCCTCTC
TGTTTGCGTGTCAACACACAAGAGGTGAGATATGGACAC
■■Homology search results ■■ -
sp_hit_id P13896
Definition sp|P13896|POLN_WEEV Non-structural polyprotein OS=Western equine encephalitis virus
Align length 40
Score (bit) 32.7
E-value 1.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912940|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_E12.
(519 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P13896|POLN_WEEV Non-structural polyprotein OS=Western equine... 33 1.0
sp|Q7ZTY6|CG026_DANRE Uncharacterized protein C7orf26 homolog OS... 32 1.4
sp|Q7Q5R7|CTLH1_ANOGA CTL-like protein 1 OS=Anopheles gambiae GN... 31 3.0
sp|P40954|CHI3_CANAL Chitinase 3 OS=Candida albicans GN=CHT3 PE=... 31 4.0
sp|Q70IB2|RNS10_BOVIN Ribonuclease-like protein 10 (Fragment) OS... 30 5.2
sp|Q17JQ7|CTLH1_AEDAE CTL-like protein 1 OS=Aedes aegypti GN=AAE... 30 6.8
sp|Q9SZW4|AHM3_ARATH Putative cadmium/zinc-transporting ATPase 3... 30 8.8
sp|O74851|ADG3_SCHPO Protein adg3 OS=Schizosaccharomyces pombe G... 30 9.0

>sp|P13896|POLN_WEEV Non-structural polyprotein OS=Western equine
encephalitis virus PE=2 SV=2
Length = 2466

Score = 32.7 bits (73), Expect = 1.0
Identities = 16/40 (40%), Positives = 23/40 (57%)
Frame = +2

Query: 170 VDRLRAILDVGSCSVQDAHSLV*IEHLFECVLTLVDAA*P 289
VDR + ILD+GS V+ AHS H + C+ ++ A P
Sbjct: 55 VDRDQVILDIGSAPVRHAHS----NHRYHCICPMISAEDP 90


>sp|Q7ZTY6|CG026_DANRE Uncharacterized protein C7orf26 homolog
OS=Danio rerio GN=zgc:56409 PE=2 SV=2
Length = 475

Score = 32.3 bits (72), Expect = 1.4
Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 6/98 (6%)
Frame = -2

Query: 359 LSAGDYLCIPQVL------MPHSILELVIMAMPHQLV*EHTQTGAQFRQASVHPGQSSCL 198
++ G LC + L +PH+ L ++M+ P H+ +HPG+ S L
Sbjct: 354 MATGALLCAREDLRALCSRLPHNNLLQLVMSGPVVQPPPHSSPFQPNMYPHIHPGRPSPL 413

Query: 197 HPV*LSIDQPHVNSASSLYFIHLGTCHHANAPSVVSHR 84
P PH ++ SS + H H P++ HR
Sbjct: 414 SP-----HSPHQSTLSSPHSPHTVLTAHPTHPALAPHR 446


>sp|Q7Q5R7|CTLH1_ANOGA CTL-like protein 1 OS=Anopheles gambiae
GN=AGAP006244 PE=3 SV=4
Length = 690

Score = 31.2 bits (69), Expect = 3.0
Identities = 17/64 (26%), Positives = 31/64 (48%)
Frame = -3

Query: 223 CILDRAAAYIQYSSQSINRM*TLQVPCTSFILELVTMPMPHLLSLIATAVFLATWIIPIA 44
CI+ I Y + + + L +L+L + P LL+ +A +VFLA W++ +
Sbjct: 293 CIMIILLVVIYYLREKLTGLAALFEEAGKCMLQLPGLAGPPLLAFLALSVFLAFWVVVVV 352

Query: 43 GFST 32
+T
Sbjct: 353 CLAT 356


>sp|P40954|CHI3_CANAL Chitinase 3 OS=Candida albicans GN=CHT3 PE=3
SV=2
Length = 567

Score = 30.8 bits (68), Expect = 4.0
Identities = 25/76 (32%), Positives = 32/76 (42%)
Frame = -1

Query: 396 STKTVQSSLYWKAISRRLLVYTASAYASFDPGACDHGYAASTSVRTHSNRCSIQTSECAS 217
ST SS K T+S+ +S ++STS T S S TS S
Sbjct: 332 STTISSSSSSSKTSKTSTTSTTSSSISSTTSSTTSSTSSSSTSSSTSSTTSSSTTSSQIS 391

Query: 216 WTEQLPTSSIALNRST 169
T PTSS +L+ ST
Sbjct: 392 TTSTAPTSSTSLSSST 407


>sp|Q70IB2|RNS10_BOVIN Ribonuclease-like protein 10 (Fragment)
OS=Bos taurus GN=RNASE10 PE=2 SV=1
Length = 162

Score = 30.4 bits (67), Expect = 5.2
Identities = 14/39 (35%), Positives = 21/39 (53%)
Frame = -2

Query: 410 LNKDGLLRQCNPHCTGKLSAGDYLCIPQVLMPHSILELV 294
L D + R+CN K+ + D+ CIPQ + H L+ V
Sbjct: 107 LRSDVMDRECNALMALKVKSKDHTCIPQYIFIHEELDAV 145


>sp|Q17JQ7|CTLH1_AEDAE CTL-like protein 1 OS=Aedes aegypti
GN=AAEL001935 PE=3 SV=1
Length = 689

Score = 30.0 bits (66), Expect = 6.8
Identities = 17/64 (26%), Positives = 32/64 (50%)
Frame = -3

Query: 223 CILDRAAAYIQYSSQSINRM*TLQVPCTSFILELVTMPMPHLLSLIATAVFLATWIIPIA 44
CI+ I Y + ++ + L +L++ + P +L+ IA AVFL+ W++ I
Sbjct: 292 CIMIILLVVIYYLREKLSGLAALFEEAGKCMLQIPGLAGPPVLAFIALAVFLSFWMVVIV 351

Query: 43 GFST 32
+T
Sbjct: 352 CLAT 355


>sp|Q9SZW4|AHM3_ARATH Putative cadmium/zinc-transporting ATPase 3
OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1
Length = 951

Score = 29.6 bits (65), Expect = 8.8
Identities = 20/62 (32%), Positives = 27/62 (43%), Gaps = 5/62 (8%)
Frame = +2

Query: 38 ETCNRDDPSCKKNSCCDERQQMGHWH-----GDKFQDE*STRNLQSLHAVDRLRAILDVG 202
ET +D+ + K SCC E +GH H GDK Q +Q + + LD G
Sbjct: 770 ETKQKDNVTVVKKSCCAEPVDLGHGHDSGCCGDKSQQP-HQHEVQVQQSCHNKPSGLDSG 828

Query: 203 SC 208
C
Sbjct: 829 CC 830


>sp|O74851|ADG3_SCHPO Protein adg3 OS=Schizosaccharomyces pombe
GN=adg3 PE=2 SV=1
Length = 1131

Score = 29.6 bits (65), Expect = 9.0
Identities = 24/94 (25%), Positives = 45/94 (47%)
Frame = -1

Query: 447 SSTIALPARLSQAQQRWSTKTVQSSLYWKAISRRLLVYTASAYASFDPGACDHGYAASTS 268
S+ + + S A + T SS + + S + ++S YAS + ++STS
Sbjct: 483 STPVTSSSIFSTATEATDTSVQTSSAIYDSSSTSNIQSSSSVYASSTGALSSNSLSSSTS 542

Query: 267 VRTHSNRCSIQTSECASWTEQLPTSSIALNRSTA 166
+ S + +S AS TE L ++S++ + S+A
Sbjct: 543 SVSTSYIPNASSSVYASSTEALSSNSLSSSTSSA 576


tr_hit_id Q6BXK5
Definition tr|Q6BXK5|Q6BXK5_DEBHA DEHA2B02222p OS=Debaryomyces hansenii
Align length 114
Score (bit) 35.8
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912940|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_E12.
(519 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q6BXK5|Q6BXK5_DEBHA DEHA2B02222p OS=Debaryomyces hansenii GN=... 36 1.3
tr|Q1KUQ4|Q1KUQ4_9ROSI Putative uncharacterized protein OS=Cleom... 27 3.2
tr|Q9LFV8|Q9LFV8_ARATH Putative uncharacterized protein F14F8_60... 27 4.0
tr|A8WVW4|A8WVW4_CAEBR Putative uncharacterized protein OS=Caeno... 33 6.5
tr|A4I523|A4I523_LEIIN Putative uncharacterized protein OS=Leish... 33 6.5
tr|Q558W6|Q558W6_DICDI Putative uncharacterized protein OS=Dicty... 33 6.5
tr|Q4Q7T0|Q4Q7T0_LEIMA Putative uncharacterized protein OS=Leish... 33 8.5
tr|A4HHX3|A4HHX3_LEIBR Putative uncharacterized protein OS=Leish... 33 8.5
tr|O10412|O10412_9VIRU Nonstructural protein 1 (Fragment) OS=For... 33 8.5
tr|O10391|O10391_9VIRU Nonstructural protein 1 (Fragment) OS=Bug... 33 8.5

>tr|Q6BXK5|Q6BXK5_DEBHA DEHA2B02222p OS=Debaryomyces hansenii
GN=DEHA2B02222g PE=4 SV=2
Length = 703

Score = 35.8 bits (81), Expect = 1.3
Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 3/114 (2%)
Frame = -1

Query: 447 SSTIALPARLSQAQQRWSTKTVQSS---LYWKAISRRLLVYTASAYASFDPGACDHGYAA 277
SS++AL + L+ + ++ +V SS +++ L T+S+ AS P A +
Sbjct: 233 SSSVALSSSLTTSSCSTTSSSVASSSSVALSSSLTTSLCSTTSSSGASSSPVALSSSVVS 292

Query: 276 STSVRTHSNRCSIQTSECASWTEQLPTSSIALNRSTACKLCKFLVLHSSWNLSP 115
+SV T S CS +S + + L TSS ++ S++ L L SS +SP
Sbjct: 293 PSSVVTSS--CSTSSSSSIALSSLLTTSSSSVASSSSVDLSSSLTTSSSSVVSP 344


>tr|Q1KUQ4|Q1KUQ4_9ROSI Putative uncharacterized protein OS=Cleome
spinosa PE=4 SV=1
Length = 1527

Score = 26.9 bits (58), Expect(2) = 3.2
Identities = 12/30 (40%), Positives = 18/30 (60%)
Frame = -2

Query: 512 YLTSCVLTRKQRGASSAQQDDYHLQSPFLR 423
++ SC K G+ +A +D YHL P+LR
Sbjct: 797 FVCSCPPDGKDAGSIAATRDMYHLIFPYLR 826



Score = 26.2 bits (56), Expect(2) = 3.2
Identities = 14/52 (26%), Positives = 30/52 (57%), Gaps = 1/52 (1%)
Frame = -1

Query: 303 GACDHGYAASTSV-RTHSNRCSIQTSECASWTEQLPTSSIALNRSTACKLCK 151
G+ H +AA+ ++ R+H C I SE +S+ +++ + + A ++ K C+
Sbjct: 828 GSEAHNHAATMALGRSHLEACEIMFSELSSFMDEVSSETEAKSKWKIQKGCR 879


>tr|Q9LFV8|Q9LFV8_ARATH Putative uncharacterized protein F14F8_60
OS=Arabidopsis thaliana GN=F14F8_60 PE=4 SV=1
Length = 2163

Score = 26.9 bits (58), Expect(2) = 4.0
Identities = 13/39 (33%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
Frame = -1

Query: 303 GACDHGYAASTSV-RTHSNRCSIQTSECASWTEQLPTSS 190
G+ H +AA+ ++ R+H C I SE AS+ E++ + +
Sbjct: 838 GSETHNHAATMALGRSHLEACEIMFSELASFMEEISSET 876



Score = 25.8 bits (55), Expect(2) = 4.0
Identities = 11/30 (36%), Positives = 18/30 (60%)
Frame = -2

Query: 512 YLTSCVLTRKQRGASSAQQDDYHLQSPFLR 423
++ SC K G+ ++ +D YHL P+LR
Sbjct: 807 FVCSCPPDGKDAGSIASTRDMYHLIFPYLR 836


>tr|A8WVW4|A8WVW4_CAEBR Putative uncharacterized protein
OS=Caenorhabditis briggsae GN=CBG03978 PE=4 SV=2
Length = 691

Score = 33.5 bits (75), Expect = 6.5
Identities = 20/71 (28%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
Frame = -1

Query: 396 STKTVQSSLYWKAISRRLLVYTASAYASFDPGACDHGYAASTSVRTHSNRCSIQ---TSE 226
++ T W + + L T S + + G C H A ++ T SNRCS + T+
Sbjct: 388 ASSTTSVDTKWTSTTNALSNATGSEFPAASTGTCQHYDAPASEYPTASNRCSNRYSYTTA 447

Query: 225 CASWTEQLPTS 193
SW E T+
Sbjct: 448 ITSWQELKETN 458


>tr|A4I523|A4I523_LEIIN Putative uncharacterized protein
OS=Leishmania infantum GN=LinJ30.0280 PE=4 SV=1
Length = 1523

Score = 33.5 bits (75), Expect = 6.5
Identities = 30/129 (23%), Positives = 54/129 (41%), Gaps = 15/129 (11%)
Frame = -1

Query: 444 STIALPARLSQAQQRWSTKTVQSSLYWKA---ISRRLLVYTASAYASFDPGACDHGYAAS 274
ST++LP R + A+ ++ + +++ +A + + +YT S AS C G AA
Sbjct: 493 STVSLPTRSTDARASAPSEPIYWTMFQQASTSFTSQTSLYTPSVVASVPKEPCAAGSAAR 552

Query: 273 TSVRTHSNRCSIQ------------TSECASWTEQLPTSSIALNRSTACKLCKFLVLHSS 130
++ T SNR + + + CA+ T P ++ AC+ C
Sbjct: 553 RALGTASNRAATKEARHGVLVGSQAAATCAAGTYANPDTA-------ACEACPSACSALL 605

Query: 129 WNLSPCQCP 103
+P CP
Sbjct: 606 TAATPVYCP 614


>tr|Q558W6|Q558W6_DICDI Putative uncharacterized protein
OS=Dictyostelium discoideum GN=DDB_0217083 PE=4 SV=1
Length = 657

Score = 33.5 bits (75), Expect = 6.5
Identities = 13/39 (33%), Positives = 21/39 (53%)
Frame = -2

Query: 161 NSASSLYFIHLGTCHHANAPSVVSHRNSCFSCNLDHPYC 45
N S L+F ++ N P++ +H++ C CN D P C
Sbjct: 67 NPNSGLFFNFKANINNDNYPTICAHKSICLICNKDSPPC 105


>tr|Q4Q7T0|Q4Q7T0_LEIMA Putative uncharacterized protein
OS=Leishmania major GN=LmjF30.0290 PE=4 SV=1
Length = 1520

Score = 33.1 bits (74), Expect = 8.5
Identities = 28/122 (22%), Positives = 52/122 (42%), Gaps = 8/122 (6%)
Frame = -1

Query: 444 STIALPARLSQAQQRWSTKTVQSSLYWKA---ISRRLLVYTASAYASFDPGACDHGYAAS 274
ST+ LP R + A+ +++++ +++ +A + + +YT S AS C G AA
Sbjct: 493 STVLLPTRSADAKASAPSESIRWTMFQQASTSFTSQTSLYTPSVVASVPKEPCAAGSAAR 552

Query: 273 TSVRTHSNRCSIQTSE-----CASWTEQLPTSSIALNRSTACKLCKFLVLHSSWNLSPCQ 109
+ T SNR + + + + E + A + AC+ C +P
Sbjct: 553 RAPGTASNRAASKEARHGVLVGSHAAETCAAGTYAKPDTAACRACPSACSALLKAATPVY 612

Query: 108 CP 103
CP
Sbjct: 613 CP 614


>tr|A4HHX3|A4HHX3_LEIBR Putative uncharacterized protein
OS=Leishmania braziliensis GN=LbrM30_V2.0300 PE=4 SV=1
Length = 1577

Score = 33.1 bits (74), Expect = 8.5
Identities = 30/116 (25%), Positives = 43/116 (37%), Gaps = 5/116 (4%)
Frame = -1

Query: 435 ALPARLSQAQQRWSTKTVQSSLYWKAISRRLLVYTASAYASFDPGACDHGYAASTSVRTH 256
A PA + Q + T+ +R L YT S AS C G+AA ++ T
Sbjct: 554 AFPAAKASLQHEFIHWTMFQQASTSFTGQRSL-YTPSIVASAPMNPCAAGHAADAALHTG 612

Query: 255 SNRCSIQTSE-----CASWTEQLPTSSIALNRSTACKLCKFLVLHSSWNLSPCQCP 103
NR + A E P + A + C++C L S +P CP
Sbjct: 613 LNRAASSEDRHRVLVGAQVAETCPAGTYAKPDTATCEVCPSLCSASPTVPTPVYCP 668


>tr|O10412|O10412_9VIRU Nonstructural protein 1 (Fragment) OS=Fort
Morgan virus GN=nsP1 PE=4 SV=1
Length = 125

Score = 33.1 bits (74), Expect = 8.5
Identities = 17/40 (42%), Positives = 23/40 (57%)
Frame = +2

Query: 170 VDRLRAILDVGSCSVQDAHSLV*IEHLFECVLTLVDAA*P 289
VDR + ILD+GS V+ AHS H + CV ++ A P
Sbjct: 7 VDREQVILDIGSAPVRHAHS----SHNYHCVCPMISAEDP 42


>tr|O10391|O10391_9VIRU Nonstructural protein 1 (Fragment) OS=Buggy
Creek virus GN=nsP1 PE=4 SV=1
Length = 125

Score = 33.1 bits (74), Expect = 8.5
Identities = 17/40 (42%), Positives = 23/40 (57%)
Frame = +2

Query: 170 VDRLRAILDVGSCSVQDAHSLV*IEHLFECVLTLVDAA*P 289
VDR + ILD+GS V+ AHS H + CV ++ A P
Sbjct: 7 VDREQVILDIGSAPVRHAHS----SHNYHCVCPMISAEDP 42