BP912948
Clone id YMU001_000024_F10
Library
Length 438
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000024_F10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAGCAAGAGCCATGCTCAAGGGCTGCAGAGTCAAGAGCTACACAAGTGTGCCACAAGAG
GGCAACAACTCGATGTGAGGGGTGCTCATTCGATGGGAGGGTGAGGAGAACCCTTTCATT
AAAATAGCCAAGAAGCCACCAGCTTGCCATATTAAGAAGGAGACAGAGTTTAAAGAAGTG
CCGATCGGTTCTGATCTGCAGGTGCGGTTGAACTTGGAGTGAGAAGCCAAGCTGTATGAA
AGAATGTGGGTTGAGCTGCACAACAGAGAGAAATGGGGCACTTAGAGAAGCTCAGAGAGA
GAGGGCTCTTGAAGGGATCATCTCAAAATTAAAAGTGGCAGTGAGCTACACAACAGAGAG
AAATGGGGCACTTCGAGAAGCTCAGAGAGAGAGGGCTCTTGAAGGGATCATCTGAAAATT
AAAATGTGGAGGAGCTCC
■■Homology search results ■■ -
sp_hit_id P07527
Definition sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Schizosaccharomyces pombe
Align length 36
Score (bit) 30.8
E-value 2.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912948|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_F10.
(438 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1 OS=Sc... 31 2.6
sp|Q5WNE3|NGLY1_CAEBR Peptide-N(4)-(N-acetyl-beta-glucosaminyl)a... 31 2.6
sp|A7MJY7|LPXH_ENTS8 UDP-2,3-diacylglucosamine hydrolase OS=Ente... 30 4.4
sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13 OS=Dict... 30 4.4
sp|Q8N531|FBXL6_HUMAN F-box/LRR-repeat protein 6 OS=Homo sapiens... 30 5.7
sp|A3DF24|DNAJ_CLOTH Chaperone protein dnaJ OS=Clostridium therm... 29 7.5

>sp|P07527|WEE1_SCHPO Mitosis inhibitor protein kinase wee1
OS=Schizosaccharomyces pombe GN=wee1 PE=1 SV=1
Length = 877

Score = 30.8 bits (68), Expect = 2.6
Identities = 16/36 (44%), Positives = 22/36 (61%)
Frame = +2

Query: 299 ERALEGIISKLKVAVSYTTERNGALREAQRERALEG 406
E+ L+ + KLKV S ERN L+E +RAL+G
Sbjct: 588 EKTLKYAVKKLKVKFSGPKERNRLLQEVSIQRALKG 623


>sp|Q5WNE3|NGLY1_CAEBR
Peptide-N(4)-(N-acetyl-beta-glucosaminyl)asparagine
amidase OS=Caenorhabditis briggsae GN=CBG08042 PE=3 SV=1
Length = 602

Score = 30.8 bits (68), Expect = 2.6
Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%)
Frame = +2

Query: 212 TWSEKPSCMKECGLSCTTE-RNGALREAQRE 301
TW ++P+C+K C L CTTE NG + ++E
Sbjct: 182 TWFDRPTCLK-CTLKCTTEGLNGTPTKEEKE 211


>sp|A7MJY7|LPXH_ENTS8 UDP-2,3-diacylglucosamine hydrolase
OS=Enterobacter sakazakii (strain ATCC BAA-894) GN=lpxH
PE=3 SV=1
Length = 240

Score = 30.0 bits (66), Expect = 4.4
Identities = 12/32 (37%), Positives = 19/32 (59%)
Frame = -1

Query: 141 WWLLGYFNERVLLTLPSNEHPSHRVVALLWHT 46
W + G+ + + TL +N P+HRVV WH+
Sbjct: 190 WLIHGHTHRPAVHTLEANGKPAHRVVLGAWHS 221


>sp|Q54V86|ABCCD_DICDI ABC transporter C family member 13
OS=Dictyostelium discoideum GN=abcC13 PE=3 SV=1
Length = 1350

Score = 30.0 bits (66), Expect = 4.4
Identities = 21/53 (39%), Positives = 31/53 (58%)
Frame = +1

Query: 28 RVKSYTSVPQEGNNSM*GVLIRWEGEENPFIKIAKKPPACHIKKETEFKEVPI 186
R++SY + P+EGN + EGEEN I + +K P+ K E EF++V I
Sbjct: 1064 RIESYINTPKEGNRFT--IDNEEEGEEN-MINLNEKWPS---KGEIEFRDVEI 1110


>sp|Q8N531|FBXL6_HUMAN F-box/LRR-repeat protein 6 OS=Homo sapiens
GN=FBXL6 PE=2 SV=1
Length = 539

Score = 29.6 bits (65), Expect = 5.7
Identities = 23/78 (29%), Positives = 34/78 (43%), Gaps = 6/78 (7%)
Frame = -3

Query: 259 AAQPTFFHTAWLLTPSSTAP------ADQNRSALL*TLSPS*YGKLVASWLF**KGSPHP 98
A+QP +HT L +P P A++ A L L P+ + +L L K HP
Sbjct: 151 ASQPALWHTVTLSSPLVGRPAKGGVKAEKKLLASLEWLMPNRFSQLQRLTLIHWKSQVHP 210

Query: 97 PIE*APLTSSCCPLVAHL 44
++ L CCP + L
Sbjct: 211 VLK---LVGECCPRLTFL 225


>sp|A3DF24|DNAJ_CLOTH Chaperone protein dnaJ OS=Clostridium
thermocellum (strain ATCC 27405 / DSM 1237) GN=dnaJ PE=3
SV=1
Length = 386

Score = 29.3 bits (64), Expect = 7.5
Identities = 16/44 (36%), Positives = 20/44 (45%), Gaps = 3/44 (6%)
Frame = +2

Query: 2 KQEPCSRAAESRATQVCH---KRATTRCEGCSFDGRVRRTLSLK 124
++ P + R VCH K T CE C GRVR+ LK
Sbjct: 187 QRTPFGQIVNVRTCDVCHGEGKIITNPCETCGGKGRVRKHTKLK 230


tr_hit_id B6T4V9
Definition tr|B6T4V9|B6T4V9_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 35
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912948|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_F10.
(438 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B6T4V9|B6T4V9_MAIZE Putative uncharacterized protein OS=Zea m... 35 1.9
tr|B4F843|B4F843_MAIZE Putative uncharacterized protein OS=Zea m... 35 1.9
tr|Q7PLH4|Q7PLH4_DROME CG15831 (Fragment) OS=Drosophila melanoga... 34 4.1
tr|Q8KL74|Q8KL74_RHIEC Putative transporter protein OS=Rhizobium... 33 5.4
tr|Q1XAA6|Q1XAA6_PARBR NAHD dehydrogenase subunit 5 OS=Paracocci... 33 9.2

>tr|B6T4V9|B6T4V9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 304

Score = 35.0 bits (79), Expect = 1.9
Identities = 15/35 (42%), Positives = 19/35 (54%)
Frame = -2

Query: 206 RTCRSEPIGTSLNSVSFLIWQAGGFLAILMKGFSS 102
RT R P+ T NS+ L W G AI+ GFS+
Sbjct: 34 RTMRPPPLSTDTNSMKILSWNVNGLQAIVQSGFSA 68


>tr|B4F843|B4F843_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 323

Score = 35.0 bits (79), Expect = 1.9
Identities = 15/35 (42%), Positives = 19/35 (54%)
Frame = -2

Query: 206 RTCRSEPIGTSLNSVSFLIWQAGGFLAILMKGFSS 102
RT R P+ T NS+ L W G AI+ GFS+
Sbjct: 53 RTMRPPPLSTDTNSMKILSWNVNGLQAIVQSGFSA 87


>tr|Q7PLH4|Q7PLH4_DROME CG15831 (Fragment) OS=Drosophila
melanogaster GN=CG15831 PE=1 SV=3
Length = 404

Score = 33.9 bits (76), Expect = 4.1
Identities = 19/60 (31%), Positives = 31/60 (51%)
Frame = +1

Query: 103 EENPFIKIAKKPPACHIKKETEFKEVPIGSDLQVRLNLE*EAKLYERMWVELHNREKWGT 282
+ P ++I +KPP C K TE +P GSDL N+ E + + +++ +R W T
Sbjct: 293 DNTPCLEILEKPPRCVFKLLTEQCHMPQGSDLAFLSNMHTEFESHPN-YIKGSDRRHWET 351


>tr|Q8KL74|Q8KL74_RHIEC Putative transporter protein OS=Rhizobium
etli (strain CFN 42 / ATCC 51251) GN=RHE_PD00174 PE=4
SV=2
Length = 407

Score = 33.5 bits (75), Expect = 5.4
Identities = 34/96 (35%), Positives = 47/96 (48%), Gaps = 11/96 (11%)
Frame = -2

Query: 269 SLLCSSTHILS-----YSLASHSKFNRTCRSEPIGTSLNSVSFLIWQAGGFLAILMKGFS 105
S+LC S I + YS A + R + + TS NS S++ QAG FLA ++ G+S
Sbjct: 106 SVLCLSWTIFAFIDRTYSTALQAIIPDIVRPKNL-TSFNSASYIAMQAGNFLAAIVTGYS 164

Query: 104 SPSHRMSTPHIELLP------SCGTLV*LLTLQPLS 15
+ M+ I LP S L+ LL QPLS
Sbjct: 165 LTAAGMNLTSI--LPGAFFGLSLLGLLALLGRQPLS 198


>tr|Q1XAA6|Q1XAA6_PARBR NAHD dehydrogenase subunit 5
OS=Paracoccidioides brasiliensis GN=nad5 PE=4 SV=1
Length = 600

Score = 32.7 bits (73), Expect = 9.2
Identities = 24/81 (29%), Positives = 39/81 (48%), Gaps = 3/81 (3%)
Frame = -1

Query: 249 PHSFIQLGFSLQVQPHLQIRTDRHFFKLCLL---LNMASWWLLGYFNERVLLTLPSNEHP 79
P F L F L + + FF L L+ + L G+FN+++LL L N +
Sbjct: 452 PTLFKLLPFILTLSLSILALIFSEFFSLYLINFKYTKLGYNLFGFFNQKLLLELFYNNYI 511

Query: 78 SHRVVALLWHTCVALDSAALE 16
++ V++L HT LD ++E
Sbjct: 512 TNTVLSLGSHTTKILDKGSVE 532