BP912956
Clone id YMU001_000024_G06
Library
Length 349
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000024_G06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGCTTTGAAGATAACACCTGGCCATGATCCAAATGACTACGAAATTGGGAAAAAATTTGG
GCTGCCTATAATAAACATCATGAACAACGATGGAAGCATGAATGAAAATGCTGGGAATTA
CAGTGGTCTTGATCGATTTGAGGCACGCAAGAAGCTTTGGGAAGACCTAGAAGCAGCAGG
CCTTGCAATAAAAATAGAACCCTACACATTAAATGTGCCAAGGTCTCAGAGAGGTGGTGA
GATAGTGGAACCACTTGTCAGCATGCAGTGGTTTGTGAAAATTCAACCGTTGGCTAAAAA
GGCATTGGAGGACAAGAGGGTGGAAGGATGTGTCTGCGGCGTTTTATCG
■■Homology search results ■■ -
sp_hit_id Q6HD68
Definition sp|Q6HD68|SYV_BACHK Valyl-tRNA synthetase OS=Bacillus thuringiensis subsp. konkukian
Align length 107
Score (bit) 131.0
E-value 9.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912956|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_G06.
(349 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q6HD68|SYV_BACHK Valyl-tRNA synthetase OS=Bacillus thuringien... 131 9e-31
sp|Q81LD3|SYV_BACAN Valyl-tRNA synthetase OS=Bacillus anthracis ... 131 9e-31
sp|Q5N3J4|SYV_SYNP6 Valyl-tRNA synthetase OS=Synechococcus sp. (... 129 3e-30
sp|Q8Y6X9|SYV_LISMO Valyl-tRNA synthetase OS=Listeria monocytoge... 129 3e-30
sp|Q817R6|SYV_BACCR Valyl-tRNA synthetase OS=Bacillus cereus (st... 129 3e-30
sp|Q633Y6|SYV_BACCZ Valyl-tRNA synthetase OS=Bacillus cereus (st... 129 6e-30
sp|Q5FKW5|SYV_LACAC Valyl-tRNA synthetase OS=Lactobacillus acido... 127 1e-29
sp|Q9K8G8|SYV_BACHD Valyl-tRNA synthetase OS=Bacillus halodurans... 127 1e-29
sp|Q72ZW8|SYV_BACC1 Valyl-tRNA synthetase OS=Bacillus cereus (st... 127 1e-29
sp|Q71ZB6|SYV_LISMF Valyl-tRNA synthetase OS=Listeria monocytoge... 127 2e-29
sp|Q8RBN5|SYV_THETN Valyl-tRNA synthetase OS=Thermoanaerobacter ... 126 3e-29
sp|Q38XD1|SYV_LACSS Valyl-tRNA synthetase OS=Lactobacillus sakei... 126 3e-29
sp|P11931|SYV_BACST Valyl-tRNA synthetase OS=Bacillus stearother... 126 4e-29
sp|Q55522|SYV_SYNY3 Valyl-tRNA synthetase OS=Synechocystis sp. (... 125 6e-29
sp|Q8EPN2|SYV_OCEIH Valyl-tRNA synthetase OS=Oceanobacillus ihey... 125 6e-29
sp|Q74JZ8|SYV_LACJO Valyl-tRNA synthetase OS=Lactobacillus johns... 125 6e-29
sp|Q05873|SYV_BACSU Valyl-tRNA synthetase OS=Bacillus subtilis G... 125 8e-29
sp|Q65GK8|SYV_BACLD Valyl-tRNA synthetase OS=Bacillus lichenifor... 125 8e-29
sp|Q92BG2|SYV_LISIN Valyl-tRNA synthetase OS=Listeria innocua GN... 124 1e-28
sp|Q82ZW6|SYV_ENTFA Valyl-tRNA synthetase OS=Enterococcus faecal... 124 1e-28
sp|Q5WEQ4|SYV_BACSK Valyl-tRNA synthetase OS=Bacillus clausii (s... 124 1e-28
sp|Q5KWL3|SYV_GEOKA Valyl-tRNA synthetase OS=Geobacillus kaustop... 124 2e-28
sp|Q9CDP6|SYV_LACLA Valyl-tRNA synthetase OS=Lactococcus lactis ... 123 2e-28
sp|P36420|SYV_LACCA Valyl-tRNA synthetase OS=Lactobacillus casei... 123 3e-28
sp|Q4L703|SYV_STAHJ Valyl-tRNA synthetase OS=Staphylococcus haem... 122 4e-28
sp|Q8XJ42|SYV_CLOPE Valyl-tRNA synthetase OS=Clostridium perfrin... 122 4e-28
sp|Q8DIS8|SYV_THEEB Valyl-tRNA synthetase OS=Thermosynechococcus... 122 7e-28
sp|Q83DD0|SYV_COXBU Valyl-tRNA synthetase OS=Coxiella burnetii G... 121 1e-27
sp|Q8EZT8|SYV_LEPIN Valyl-tRNA synthetase OS=Leptospira interrog... 120 2e-27
sp|Q72V30|SYV_LEPIC Valyl-tRNA synthetase OS=Leptospira interrog... 120 2e-27

>sp|Q6HD68|SYV_BACHK Valyl-tRNA synthetase OS=Bacillus thuringiensis
subsp. konkukian GN=valS PE=3 SV=1
Length = 881

Score = 131 bits (330), Expect = 9e-31
Identities = 60/107 (56%), Positives = 82/107 (76%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
+KITP HDPND+E+G + LP I +MN DGSMNE AG Y+G+DRFE RK L +DL+ AG+
Sbjct: 276 VKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGV 335

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALEDKRVE 325
++IEP+ +V S+R G +VEP +S QWFVK+ PLA+KA+E ++ E
Sbjct: 336 LVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAIELQQKE 382


>sp|Q81LD3|SYV_BACAN Valyl-tRNA synthetase OS=Bacillus anthracis
GN=valS PE=3 SV=1
Length = 881

Score = 131 bits (330), Expect = 9e-31
Identities = 60/107 (56%), Positives = 82/107 (76%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
+KITP HDPND+E+G + LP I +MN DGSMNE AG Y+G+DRFE RK L +DL+ AG+
Sbjct: 276 VKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGV 335

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALEDKRVE 325
++IEP+ +V S+R G +VEP +S QWFVK+ PLA+KA+E ++ E
Sbjct: 336 LVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAIELQQKE 382


>sp|Q5N3J4|SYV_SYNP6 Valyl-tRNA synthetase OS=Synechococcus sp.
(strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=valS
PE=3 SV=1
Length = 909

Score = 129 bits (325), Expect = 3e-30
Identities = 59/102 (57%), Positives = 78/102 (76%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
+K+TP HDPND+ +G++ LP+I +MN DG+MNENAG + GLDRFEARK + LE AG
Sbjct: 276 VKVTPAHDPNDFAMGQRHQLPLITVMNKDGTMNENAGQFEGLDRFEARKAVVAALEEAGF 335

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALE 310
+K+E Y ++P S RG VEPL+S QWFVKI+PLA++ALE
Sbjct: 336 LVKVEDYRHSIPISDRGKVPVEPLLSTQWFVKIEPLAQRALE 377


>sp|Q8Y6X9|SYV_LISMO Valyl-tRNA synthetase OS=Listeria monocytogenes
GN=valS PE=3 SV=1
Length = 883

Score = 129 bits (325), Expect = 3e-30
Identities = 61/111 (54%), Positives = 83/111 (74%)
Frame = +2

Query: 2 ALKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAG 181
A+KITP HDPND+E+G + LP I +M+ DG+MNENAG Y GLDRF ARK++ +D + G
Sbjct: 277 AVKITPAHDPNDFEVGNRHNLPRIIVMHEDGTMNENAGKYDGLDRFVARKEIIQDFKDLG 336

Query: 182 LAIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALEDKRVEGCV 334
L IK EP+ +V S+R G +VEP +S+QWFVK++PLA +ALE ++ E V
Sbjct: 337 LFIKQEPHLHSVGHSERTGAVVEPYLSLQWFVKMEPLAAEALELQKTENKV 387


>sp|Q817R6|SYV_BACCR Valyl-tRNA synthetase OS=Bacillus cereus
(strain ATCC 14579 / DSM 31) GN=valS PE=3 SV=1
Length = 881

Score = 129 bits (325), Expect = 3e-30
Identities = 58/101 (57%), Positives = 79/101 (78%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
+KITP HDPND+E+G + LP I +MN DGSMNE AG Y+G+DRFE RK+L +DL+ AG+
Sbjct: 276 VKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKELVKDLQEAGV 335

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKAL 307
++IEP+ +V S+R G +VEP +S QWFVK+ PLA+KA+
Sbjct: 336 LVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAV 376


>sp|Q633Y6|SYV_BACCZ Valyl-tRNA synthetase OS=Bacillus cereus
(strain ZK / E33L) GN=valS PE=3 SV=1
Length = 881

Score = 129 bits (323), Expect = 6e-30
Identities = 58/101 (57%), Positives = 78/101 (77%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
+KITP HDPND+E+G + LP I +MN DGSMNE AG Y+G+DRFE RK L +DL+ AG+
Sbjct: 276 VKITPAHDPNDFEVGNRHDLPRILVMNEDGSMNEKAGKYNGMDRFECRKALVKDLQEAGV 335

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKAL 307
++IEP+ +V S+R G +VEP +S QWFVK+ PLA+KA+
Sbjct: 336 LVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAV 376


>sp|Q5FKW5|SYV_LACAC Valyl-tRNA synthetase OS=Lactobacillus
acidophilus GN=valS PE=3 SV=1
Length = 879

Score = 127 bits (320), Expect = 1e-29
Identities = 59/110 (53%), Positives = 81/110 (73%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
+KITP HDPND+++G + L IN+MN+DG+MNE AG Y+G+DRFE R+ L +DL+ G
Sbjct: 272 VKITPAHDPNDFQVGNRHNLKRINVMNDDGTMNEEAGKYAGMDRFECREALVKDLKEEGY 331

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALEDKRVEGCV 334
IK+EP +V S+R G VEP +S QWFVK++PLA K LE+++ EG V
Sbjct: 332 LIKVEPIVHSVGHSERSGVQVEPRLSKQWFVKMKPLADKVLENQKSEGKV 381


>sp|Q9K8G8|SYV_BACHD Valyl-tRNA synthetase OS=Bacillus halodurans
GN=valS PE=3 SV=1
Length = 880

Score = 127 bits (320), Expect = 1e-29
Identities = 59/111 (53%), Positives = 81/111 (72%)
Frame = +2

Query: 2 ALKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAG 181
A+KITP HDPND+EIG + LP I +MN DG+MNE AG Y G+DRFE RK++ +DL+ G
Sbjct: 275 AVKITPAHDPNDFEIGNRHNLPRILVMNEDGTMNEKAGQYEGMDRFECRKQIVKDLQEQG 334

Query: 182 LAIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALEDKRVEGCV 334
+ KIE + +V S+R G +VEP +S QWFVK++PLA++A+E + E V
Sbjct: 335 VLFKIEEHVHSVGHSERSGAVVEPYLSTQWFVKMKPLAEQAIELQTTENKV 385


>sp|Q72ZW8|SYV_BACC1 Valyl-tRNA synthetase OS=Bacillus cereus
(strain ATCC 10987) GN=valS PE=3 SV=1
Length = 881

Score = 127 bits (320), Expect = 1e-29
Identities = 57/101 (56%), Positives = 78/101 (77%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
+KITP HDPND+E+G + LP I +MN DG+MNE AG Y+G+DRFE RK L +DL+ AG+
Sbjct: 276 VKITPAHDPNDFEVGNRHDLPRILVMNEDGTMNEKAGKYNGMDRFECRKALVKDLQEAGV 335

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKAL 307
++IEP+ +V S+R G +VEP +S QWFVK+ PLA+KA+
Sbjct: 336 LVEIEPHMHSVGHSERSGAVVEPYLSTQWFVKMAPLAEKAV 376


>sp|Q71ZB6|SYV_LISMF Valyl-tRNA synthetase OS=Listeria monocytogenes
serotype 4b (strain F2365) GN=valS PE=3 SV=1
Length = 883

Score = 127 bits (319), Expect = 2e-29
Identities = 60/111 (54%), Positives = 83/111 (74%)
Frame = +2

Query: 2 ALKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAG 181
A+KITP HDPND+E+G + LP I +M+ DG+MN+NAG Y GLDRF ARK++ +D + G
Sbjct: 277 AVKITPAHDPNDFEVGNRHELPRIIVMHEDGTMNKNAGKYDGLDRFVARKEIIQDFKDLG 336

Query: 182 LAIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALEDKRVEGCV 334
L IK EP+ +V S+R G +VEP +S+QWFVK++PLA +ALE ++ E V
Sbjct: 337 LFIKQEPHLHSVGHSERTGAVVEPYLSLQWFVKMEPLAAEALELQKTENKV 387


tr_hit_id B7G3Y1
Definition tr|B7G3Y1|B7G3Y1_PHATR Predicted protein OS=Phaeodactylum tricornutum CCAP 1055/1
Align length 103
Score (bit) 160.0
E-value 3.0e-38
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912956|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_G06.
(349 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7G3Y1|B7G3Y1_PHATR Predicted protein OS=Phaeodactylum tricor... 160 3e-38
tr|A9SEL3|A9SEL3_PHYPA Predicted protein OS=Physcomitrella paten... 157 2e-37
tr|A7QL17|A7QL17_VITVI Chromosome undetermined scaffold_116, who... 157 2e-37
tr|A4S1W6|A4S1W6_OSTLU Predicted protein OS=Ostreococcus lucimar... 157 3e-37
tr|A7QLL7|A7QLL7_VITVI Chromosome chr13 scaffold_120, whole geno... 155 1e-36
tr|Q7EZJ3|Q7EZJ3_ORYSJ Putative valyl-tRNA synthetase OS=Oryza s... 154 3e-36
tr|B8B7K0|B8B7K0_ORYSI Putative uncharacterized protein OS=Oryza... 154 3e-36
tr|A3BGV0|A3BGV0_ORYSJ Putative uncharacterized protein OS=Oryza... 154 3e-36
tr|B8CEW1|B8CEW1_THAPS Valine--tRNA ligase-like protein OS=Thala... 150 3e-35
tr|Q012S5|Q012S5_OSTTA TRNA synthetase class I (ISS) OS=Ostreoco... 149 5e-35
tr|A8IU68|A8IU68_CHLRE Predicted protein OS=Chlamydomonas reinha... 145 1e-33
tr|B1YJU7|B1YJU7_EXIS2 Valyl-tRNA synthetase OS=Exiguobacterium ... 135 1e-30
tr|Q1GAU9|Q1GAU9_LACDA Valyl-tRNA synthetase OS=Lactobacillus de... 134 2e-30
tr|Q04B87|Q04B87_LACDB Valyl-tRNA synthetase OS=Lactobacillus de... 134 2e-30
tr|Q9LFE6|Q9LFE6_ARATH Valine--tRNA ligase-like protein OS=Arabi... 134 3e-30
tr|B8GBL6|B8GBL6_9CHLR Valyl-tRNA synthetase OS=Chloroflexus agg... 132 7e-30
tr|B7JQ51|B7JQ51_BACCE Valyl-tRNA synthetase OS=Bacillus cereus ... 131 1e-29
tr|B3YUM4|B3YUM4_BACCE Valyl-tRNA synthetase OS=Bacillus cereus ... 131 1e-29
tr|B3J5W4|B3J5W4_BACAN Valyl-tRNA synthetase OS=Bacillus anthrac... 131 1e-29
tr|B1UUX4|B1UUX4_BACAN Valyl-tRNA synthetase OS=Bacillus anthrac... 131 1e-29
tr|B1GN19|B1GN19_BACAN Valyl-tRNA synthetase OS=Bacillus anthrac... 131 1e-29
tr|B1F3K9|B1F3K9_BACAN Valyl-tRNA synthetase OS=Bacillus anthrac... 131 1e-29
tr|B0QP44|B0QP44_BACAN Valyl-tRNA synthetase OS=Bacillus anthrac... 131 1e-29
tr|B0Q6R4|B0Q6R4_BACAN Valyl-tRNA synthetase OS=Bacillus anthrac... 131 1e-29
tr|B0AUY7|B0AUY7_BACAN Valyl-tRNA synthetase OS=Bacillus anthrac... 131 1e-29
tr|A0RJ75|A0RJ75_BACAH Valyl-tRNA synthetase OS=Bacillus thuring... 131 2e-29
tr|B3ZNR0|B3ZNR0_BACCE Valyl-tRNA synthetase OS=Bacillus cereus ... 131 2e-29
tr|A9VIT2|A9VIT2_BACWK Valyl-tRNA synthetase OS=Bacillus weihens... 130 2e-29
tr|B2QDF5|B2QDF5_9BACL Valyl-tRNA synthetase OS=Exiguobacterium ... 130 2e-29
tr|A9WJF0|A9WJF0_CHLAA Valyl-tRNA synthetase OS=Chloroflexus aur... 130 3e-29

>tr|B7G3Y1|B7G3Y1_PHATR Predicted protein OS=Phaeodactylum
tricornutum CCAP 1055/1 GN=PHATRDRAFT_21513 PE=4 SV=1
Length = 1035

Score = 160 bits (405), Expect = 3e-38
Identities = 74/103 (71%), Positives = 84/103 (81%)
Frame = +2

Query: 2 ALKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAG 181
ALKITPGHDPNDY +GKKF LPIINIMN DGSMN NAG Y GLDRFE R++LW D+E G
Sbjct: 381 ALKITPGHDPNDYTLGKKFDLPIINIMNKDGSMNANAGQYDGLDRFECRQQLWTDMETEG 440

Query: 182 LAIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALE 310
L IK +P+T VPRSQRGGEI+EPLVS QWFVK + + KAL+
Sbjct: 441 LVIKADPHTQRVPRSQRGGEIIEPLVSSQWFVKTEGMGAKALK 483


>tr|A9SEL3|A9SEL3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_128528 PE=3 SV=1
Length = 906

Score = 157 bits (397), Expect = 2e-37
Identities = 78/103 (75%), Positives = 84/103 (81%)
Frame = +2

Query: 2 ALKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAG 181
ALKITPGHDPNDY IGKK GLP INI N D ++NENAG Y FEAR KLWEDLE +G
Sbjct: 272 ALKITPGHDPNDYAIGKKLGLPFINIFNKDATLNENAGAYW----FEARTKLWEDLEKSG 327

Query: 182 LAIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALE 310
LAIK EPYTL VPRSQRGGE+VEPLVS QWFV +QPLA KAL+
Sbjct: 328 LAIKAEPYTLRVPRSQRGGEVVEPLVSKQWFVIMQPLADKALK 370


>tr|A7QL17|A7QL17_VITVI Chromosome undetermined scaffold_116, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00001380001 PE=4 SV=1
Length = 505

Score = 157 bits (397), Expect = 2e-37
Identities = 72/102 (70%), Positives = 87/102 (85%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
LKI+PGHD NDY + +K GLPI+N+MN DG++NE AG Y GLDRFEARKKLW DLE GL
Sbjct: 71 LKISPGHDHNDYLLARKLGLPILNVMNKDGTLNEVAGLYRGLDRFEARKKLWLDLEETGL 130

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALE 310
A+K EP+TL VPRSQRGGE++EPLVS QWFV ++PLA+KAL+
Sbjct: 131 AVKKEPHTLRVPRSQRGGEVIEPLVSKQWFVTMEPLAEKALQ 172


>tr|A4S1W6|A4S1W6_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_42662 PE=3 SV=1
Length = 924

Score = 157 bits (396), Expect = 3e-37
Identities = 71/103 (68%), Positives = 86/103 (83%)
Frame = +2

Query: 2 ALKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAG 181
ALKITPGHDPNDYEIGK+ GL +INIMN DGSMN N G Y+G+DR + RK+LW D+EA G
Sbjct: 282 ALKITPGHDPNDYEIGKRVGLDLINIMNKDGSMNSNCGKYAGIDRADCRKQLWADMEAEG 341

Query: 182 LAIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALE 310
LAIK EPYT VPRSQRGGEI+EP+VS QWF K++ +A+ +L+
Sbjct: 342 LAIKAEPYTNRVPRSQRGGEIIEPIVSEQWFCKMETMAEPSLK 384


>tr|A7QLL7|A7QLL7_VITVI Chromosome chr13 scaffold_120, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001677001
PE=3 SV=1
Length = 946

Score = 155 bits (391), Expect = 1e-36
Identities = 71/102 (69%), Positives = 85/102 (83%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
LKI PGHD NDY + +K GLPI+N+MN DG++NE AG Y G DRFEARKKLW DLE GL
Sbjct: 326 LKIIPGHDHNDYLLARKLGLPILNVMNKDGTLNEVAGLYCGFDRFEARKKLWLDLEETGL 385

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALE 310
A+K EP+TL VPRSQRGGE++EPLVS QWFV ++PLA+KAL+
Sbjct: 386 AVKKEPHTLRVPRSQRGGEVIEPLVSKQWFVTMEPLAEKALQ 427


>tr|Q7EZJ3|Q7EZJ3_ORYSJ Putative valyl-tRNA synthetase OS=Oryza
sativa subsp. japonica GN=P0428D12.115 PE=3 SV=1
Length = 945

Score = 154 bits (388), Expect = 3e-36
Identities = 69/101 (68%), Positives = 84/101 (83%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
LKI+PGHD NDY I +K GLPI+N+MN DG++N+ AG YSG+DRFEAR+KLW DL L
Sbjct: 306 LKISPGHDHNDYHIARKLGLPILNVMNKDGTLNDVAGLYSGMDRFEAREKLWSDLVETNL 365

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKAL 307
A+K EPYTL VPRSQRGGE++EPL+S QWFV + PLA+KAL
Sbjct: 366 AVKKEPYTLRVPRSQRGGEVIEPLISKQWFVTMDPLAEKAL 406


>tr|B8B7K0|B8B7K0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_25003 PE=4 SV=1
Length = 958

Score = 154 bits (388), Expect = 3e-36
Identities = 69/101 (68%), Positives = 84/101 (83%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
LKI+PGHD NDY I +K GLPI+N+MN DG++N+ AG YSG+DRFEAR+KLW DL L
Sbjct: 324 LKISPGHDHNDYHIARKLGLPILNVMNKDGTLNDVAGLYSGMDRFEAREKLWSDLVETNL 383

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKAL 307
A+K EPYTL VPRSQRGGE++EPL+S QWFV + PLA+KAL
Sbjct: 384 AVKKEPYTLRVPRSQRGGEVIEPLISKQWFVTMDPLAEKAL 424


>tr|A3BGV0|A3BGV0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_022272 PE=3 SV=1
Length = 1002

Score = 154 bits (388), Expect = 3e-36
Identities = 69/101 (68%), Positives = 84/101 (83%)
Frame = +2

Query: 5 LKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAGL 184
LKI+PGHD NDY I +K GLPI+N+MN DG++N+ AG YSG+DRFEAR+KLW DL L
Sbjct: 326 LKISPGHDHNDYHIARKLGLPILNVMNKDGTLNDVAGLYSGMDRFEAREKLWSDLVETNL 385

Query: 185 AIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKAL 307
A+K EPYTL VPRSQRGGE++EPL+S QWFV + PLA+KAL
Sbjct: 386 AVKKEPYTLRVPRSQRGGEVIEPLISKQWFVTMDPLAEKAL 426


>tr|B8CEW1|B8CEW1_THAPS Valine--tRNA ligase-like protein
OS=Thalassiosira pseudonana CCMP1335 GN=THAPSDRAFT_42971
PE=4 SV=1
Length = 891

Score = 150 bits (379), Expect = 3e-35
Identities = 71/103 (68%), Positives = 82/103 (79%), Gaps = 1/103 (0%)
Frame = +2

Query: 2 ALKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGN-YSGLDRFEARKKLWEDLEAA 178
ALKITPGHDPNDYE+GKKF L I+NIMN D +MN+ G Y GLDRFEAR +LW D+E
Sbjct: 238 ALKITPGHDPNDYELGKKFDLEIMNIMNKDATMNKECGEKYEGLDRFEARDRLWSDMEDE 297

Query: 179 GLAIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKAL 307
GL IK+EP+T VPRSQRGGEI+EPLVS QWFVK + + KAL
Sbjct: 298 GLVIKVEPHTQRVPRSQRGGEIIEPLVSKQWFVKTEGMGAKAL 340


>tr|Q012S5|Q012S5_OSTTA TRNA synthetase class I (ISS)
OS=Ostreococcus tauri GN=Ot08g03670 PE=3 SV=1
Length = 985

Score = 149 bits (377), Expect = 5e-35
Identities = 67/103 (65%), Positives = 84/103 (81%)
Frame = +2

Query: 2 ALKITPGHDPNDYEIGKKFGLPIINIMNNDGSMNENAGNYSGLDRFEARKKLWEDLEAAG 181
ALKITPGHDPNDYEIGK+ GL +INI+N DG+MN N G Y+G+DR + RK+LW D+EA G
Sbjct: 330 ALKITPGHDPNDYEIGKRVGLDMINILNKDGTMNANCGKYTGIDRADCRKQLWADMEAEG 389

Query: 182 LAIKIEPYTLNVPRSQRGGEIVEPLVSMQWFVKIQPLAKKALE 310
LAIK E YT VPRSQRGGE++EP+VS QWF K+ +A+ +L+
Sbjct: 390 LAIKAEAYTNRVPRSQRGGEVIEPIVSEQWFCKMDSMAEPSLK 432