BP912960
Clone id YMU001_000024_G10
Library
Length 441
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000024_G10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTCCATAACTCTCAGAAAATAAGGCTTTGTTGAGTTATATTGTGTTGTTGACCAAGCGAT
CAACACTTCCCCCCTCCGAATTCATGTCATCCCTGACATGATCTATGTTGCTGATGTCAG
TGCGGTCCTTGCTGTCATTTTGCTCTGGTATGATTTAGTGAGTTTCCTTTTGTTTATGTG
TATGTGGGTTGAGTGGTGTAGTTGAGAGTAGTGAGGAGGGTTCTTTACAAGGAGGAGATA
AGCATGGTGCTAGGGTGTTTCCATGAAGAGAGCAAACATCGAGGTAAAGACCAGGTGTTG
TTTTCAGTGCTAATAGTAGGTTTATGGTGGCCTTCCATAGTAAAGGATGTACATCTGGTG
TAAAACCTACCACAAATGTCAAACCATGGATGAAAGACGATTGGTAGTAGAGTCATAGGG
GGGAATTATTACACAAAGTGA
■■Homology search results ■■ -
sp_hit_id Q58DD0
Definition sp|Q58DD0|ACE2_BOVIN Angiotensin-converting enzyme 2 OS=Bos taurus
Align length 38
Score (bit) 30.8
E-value 2.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912960|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_G10.
(441 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q58DD0|ACE2_BOVIN Angiotensin-converting enzyme 2 OS=Bos taur... 31 2.6
sp|Q657G7|CAF2P_ORYSJ CRS2-associated factor 2, chloroplastic OS... 30 3.4
sp|P60019|GPR34_PANTR Probable G-protein coupled receptor 34 OS=... 30 3.4
sp|Q3SAG9|GPR34_PANPA Probable G-protein coupled receptor 34 OS=... 30 3.4
sp|Q9UPC5|GPR34_HUMAN Probable G-protein coupled receptor 34 OS=... 30 3.4
sp|Q6XCF2|GPR34_GORGO Probable G-protein coupled receptor 34 OS=... 30 3.4
sp|Q5UR96|YL576_MIMIV Uncharacterized protein L576 OS=Acanthamoe... 30 4.4
sp|Q10743|ADA10_RAT ADAM 10 (Fragment) OS=Rattus norvegicus GN=A... 30 4.4
sp|O14672|ADA10_HUMAN ADAM 10 OS=Homo sapiens GN=ADAM10 PE=1 SV=1 30 4.4
sp|Q10741|ADA10_BOVIN ADAM 10 OS=Bos taurus GN=ADAM10 PE=1 SV=1 30 4.4
sp|Q7ZWF4|RN145_DANRE RING finger protein 145 OS=Danio rerio GN=... 30 5.7
sp|O76942|PTP1_ENCCU Major polar tube protein OS=Encephalitozoon... 30 5.7
sp|Q75B10|LKHA4_ASHGO Leukotriene A-4 hydrolase OS=Ashbya gossyp... 30 5.7
sp|Q7TQM3|FGRL1_RAT Fibroblast growth factor receptor-like 1 OS=... 30 5.7
sp|Q93WF1|PEL20_ARATH Probable pectate lyase 20 OS=Arabidopsis t... 29 9.8
sp|Q940Q1|PEL1_ARATH Probable pectate lyase 1 OS=Arabidopsis tha... 29 9.8
sp|Q9R1K6|GPR34_MOUSE Probable G-protein coupled receptor 34 OS=... 29 10.0

>sp|Q58DD0|ACE2_BOVIN Angiotensin-converting enzyme 2 OS=Bos taurus
GN=ACE2 PE=2 SV=1
Length = 804

Score = 30.8 bits (68), Expect = 2.6
Identities = 15/38 (39%), Positives = 20/38 (52%), Gaps = 4/38 (10%)
Frame = -2

Query: 380 DICGRFYTRCTSFTMEGHHKPTIST----ENNTWSLPR 279
D+ GRF+T S T+ HKP+I EN +W R
Sbjct: 268 DMWGRFWTNLYSLTVPFEHKPSIDVTEKMENQSWDAER 305


>sp|Q657G7|CAF2P_ORYSJ CRS2-associated factor 2, chloroplastic
OS=Oryza sativa subsp. japonica GN=Os01g0323300 PE=2
SV=1
Length = 607

Score = 30.4 bits (67), Expect = 3.4
Identities = 15/52 (28%), Positives = 28/52 (53%), Gaps = 6/52 (11%)
Frame = -3

Query: 220 PSSLLSTTPLNP------HTHKQKETH*IIPEQNDSKDRTDISNIDHVRDDM 83
P+ L++ NP +T + ET + P+Q++ + +D++ DH DDM
Sbjct: 531 PAVLVANDESNPDVLNAEYTEDEPETGTLEPQQHEFTESSDVAEDDHFEDDM 582


>sp|P60019|GPR34_PANTR Probable G-protein coupled receptor 34 OS=Pan
troglodytes GN=GPR34 PE=3 SV=1
Length = 381

Score = 30.4 bits (67), Expect = 3.4
Identities = 9/25 (36%), Positives = 16/25 (64%)
Frame = +1

Query: 256 CFHEESKHRGKDQVLFSVLIVGLWW 330
CFH KH K + +F+ ++V ++W
Sbjct: 204 CFHYRDKHNAKGEAIFNFILVVMFW 228


>sp|Q3SAG9|GPR34_PANPA Probable G-protein coupled receptor 34 OS=Pan
paniscus GN=GPR34 PE=2 SV=1
Length = 381

Score = 30.4 bits (67), Expect = 3.4
Identities = 9/25 (36%), Positives = 16/25 (64%)
Frame = +1

Query: 256 CFHEESKHRGKDQVLFSVLIVGLWW 330
CFH KH K + +F+ ++V ++W
Sbjct: 204 CFHYRDKHNAKGEAIFNFILVVMFW 228


>sp|Q9UPC5|GPR34_HUMAN Probable G-protein coupled receptor 34
OS=Homo sapiens GN=GPR34 PE=2 SV=2
Length = 381

Score = 30.4 bits (67), Expect = 3.4
Identities = 9/25 (36%), Positives = 16/25 (64%)
Frame = +1

Query: 256 CFHEESKHRGKDQVLFSVLIVGLWW 330
CFH KH K + +F+ ++V ++W
Sbjct: 204 CFHYRDKHNAKGEAIFNFILVVMFW 228


>sp|Q6XCF2|GPR34_GORGO Probable G-protein coupled receptor 34
OS=Gorilla gorilla gorilla GN=GPR34 PE=3 SV=1
Length = 381

Score = 30.4 bits (67), Expect = 3.4
Identities = 9/25 (36%), Positives = 16/25 (64%)
Frame = +1

Query: 256 CFHEESKHRGKDQVLFSVLIVGLWW 330
CFH KH K + +F+ ++V ++W
Sbjct: 204 CFHYRDKHNAKGEAIFNFILVVMFW 228


>sp|Q5UR96|YL576_MIMIV Uncharacterized protein L576 OS=Acanthamoeba
polyphaga mimivirus GN=MIMI_L576 PE=4 SV=1
Length = 274

Score = 30.0 bits (66), Expect = 4.4
Identities = 15/38 (39%), Positives = 23/38 (60%)
Frame = -2

Query: 392 HPWFDICGRFYTRCTSFTMEGHHKPTISTENNTWSLPR 279
H F ICG + T SF ++G + PTI+ N++S P+
Sbjct: 73 HKKFKICGAYITDLRSFKIKGVNDPTINF--NSFSFPQ 108


>sp|Q10743|ADA10_RAT ADAM 10 (Fragment) OS=Rattus norvegicus
GN=Adam10 PE=2 SV=1
Length = 544

Score = 30.0 bits (66), Expect = 4.4
Identities = 16/58 (27%), Positives = 27/58 (46%)
Frame = -3

Query: 337 WKATINLLLALKTTPGLYLDVCSLHGNTLAPCLSPPCKEPSSLLSTTPLNPHTHKQKE 164
W A + + +AL ++ +CS+H + P L PP P +L P P Q++
Sbjct: 474 WWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQ 531


>sp|O14672|ADA10_HUMAN ADAM 10 OS=Homo sapiens GN=ADAM10 PE=1 SV=1
Length = 748

Score = 30.0 bits (66), Expect = 4.4
Identities = 16/58 (27%), Positives = 27/58 (46%)
Frame = -3

Query: 337 WKATINLLLALKTTPGLYLDVCSLHGNTLAPCLSPPCKEPSSLLSTTPLNPHTHKQKE 164
W A + + +AL ++ +CS+H + P L PP P +L P P Q++
Sbjct: 678 WWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQ 735


>sp|Q10741|ADA10_BOVIN ADAM 10 OS=Bos taurus GN=ADAM10 PE=1 SV=1
Length = 748

Score = 30.0 bits (66), Expect = 4.4
Identities = 16/58 (27%), Positives = 27/58 (46%)
Frame = -3

Query: 337 WKATINLLLALKTTPGLYLDVCSLHGNTLAPCLSPPCKEPSSLLSTTPLNPHTHKQKE 164
W A + + +AL ++ +CS+H + P L PP P +L P P Q++
Sbjct: 678 WWAVLLMGIALIMLMAGFIKICSVHTPSSNPKLPPPKPLPGTLKRRRPPQPIQQPQRQ 735


tr_hit_id Q9PW10
Definition tr|Q9PW10|Q9PW10_CHICK CHUNK-1 protein OS=Gallus gallus
Align length 66
Score (bit) 35.4
E-value 1.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912960|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_G10.
(441 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9PW10|Q9PW10_CHICK CHUNK-1 protein OS=Gallus gallus GN=chunk... 35 1.4
tr|Q9MAR5|Q9MAR5_ARATH F28H19.8 protein OS=Arabidopsis thaliana ... 33 7.0
tr|A5AHC2|A5AHC2_VITVI Putative uncharacterized protein OS=Vitis... 33 7.0
tr|A0YJ28|A0YJ28_9CYAN Hydrogenase maturation protein OS=Lyngbya... 33 7.0
tr|A6SLG4|A6SLG4_BOTFB Putative uncharacterized protein OS=Botry... 33 7.0
tr|Q8LDL6|Q8LDL6_ARATH Putative uncharacterized protein OS=Arabi... 31 7.6
tr|Q0WWX8|Q0WWX8_ARATH Putative uncharacterized protein At1g2251... 31 7.6

>tr|Q9PW10|Q9PW10_CHICK CHUNK-1 protein OS=Gallus gallus GN=chunk-1
PE=2 SV=1
Length = 308

Score = 35.4 bits (80), Expect = 1.4
Identities = 21/66 (31%), Positives = 32/66 (48%), Gaps = 9/66 (13%)
Frame = -3

Query: 361 TPDVHPL----LWKATINLLLALKTTPGLYLDVCSLHGNT-----LAPCLSPPCKEPSSL 209
+P +H L LW+A +L +L + L+L C+ H + L PPC +P
Sbjct: 171 SPSLHRLCIHQLWQAVKKMLTSLAKSFSLFLTTCATHSFQPQWFPFSLPLPPPCMDPQFF 230

Query: 208 LSTTPL 191
+S TPL
Sbjct: 231 ISHTPL 236


>tr|Q9MAR5|Q9MAR5_ARATH F28H19.8 protein OS=Arabidopsis thaliana
GN=F28H19.8 PE=4 SV=1
Length = 640

Score = 33.1 bits (74), Expect = 7.0
Identities = 17/44 (38%), Positives = 22/44 (50%), Gaps = 2/44 (4%)
Frame = +1

Query: 229 KEEISMVLGCFHEE--SKHRGKDQVLFSVLIVGLWWPSIVKDVH 354
+EE+ VL H H + + VL GLWWPS+ KD H
Sbjct: 486 EEEVQGVLELCHNSPYGGHFATFKTVQKVLQAGLWWPSMFKDAH 529


>tr|A5AHC2|A5AHC2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_019166 PE=4 SV=1
Length = 1270

Score = 33.1 bits (74), Expect = 7.0
Identities = 14/44 (31%), Positives = 23/44 (52%), Gaps = 2/44 (4%)
Frame = +1

Query: 229 KEEISMVLGCFHEES--KHRGKDQVLFSVLIVGLWWPSIVKDVH 354
++E S +L H+ + H ++ V+ G WWPS+ KD H
Sbjct: 308 EQEQSRILSHCHDSACGGHFASQKIAMKVIQSGFWWPSLFKDAH 351


>tr|A0YJ28|A0YJ28_9CYAN Hydrogenase maturation protein OS=Lyngbya
sp. PCC 8106 GN=L8106_01902 PE=4 SV=1
Length = 796

Score = 33.1 bits (74), Expect = 7.0
Identities = 38/144 (26%), Positives = 62/144 (43%), Gaps = 14/144 (9%)
Frame = -3

Query: 427 NSPL*LYYQSSFIHGLTFVVGFTPDVHPLLWKATINLLLALKTTPGLYLDVCSLHGNTLA 248
+ PL L + I FV TP+ LL + ++L + T D+ SL N +A
Sbjct: 257 DKPLALMADINIIEKYCFV---TPEERELLESSAAPIVLLRRKTSFKQSDI-SLSKNQIA 312

Query: 247 PCLSPPCKEPSSLLSTTPLNPHTHKQKETH*IIPEQNDSKD---------RTDISN---- 107
P ++P +L TPL+ ++ E ++ N S D R+ +SN
Sbjct: 313 PSIAPAQNYLGFMLPYTPLHHLALRRLEVPIVLTSANFSDDPQCIDNAEVRSKLSNVADY 372

Query: 106 -IDHVRDDMNSEGGSVDRLVNNTI 38
I H R+ +N SV R+ N+ +
Sbjct: 373 FIFHNREIVNRVDDSVVRINNHRL 396


>tr|A6SLG4|A6SLG4_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_13574
PE=4 SV=1
Length = 280

Score = 33.1 bits (74), Expect = 7.0
Identities = 27/98 (27%), Positives = 39/98 (39%), Gaps = 19/98 (19%)
Frame = -3

Query: 379 TFVVGFTPDVH-PLLWKATINLLLALKTTPGLYLDVCSLHGNTL---------------A 248
TF GFT D+H PL W + N + + P + + G +L
Sbjct: 71 TFFAGFTSDLHNPLFWTSFYNSVREKHSLPSTIPPIPQIDGESLFWSMMDNSRELDPWMY 130

Query: 247 PC---LSPPCKEPSSLLSTTPLNPHTHKQKETH*IIPE 143
PC L K + LS T + P +H ++H IPE
Sbjct: 131 PCLQKLKASKKYTLAGLSNTVIFPPSHPYSKSHSFIPE 168


>tr|Q8LDL6|Q8LDL6_ARATH Putative uncharacterized protein
OS=Arabidopsis thaliana PE=2 SV=1
Length = 185

Score = 30.8 bits (68), Expect(2) = 7.6
Identities = 12/20 (60%), Positives = 14/20 (70%)
Frame = -3

Query: 265 HGNTLAPCLSPPCKEPSSLL 206
HG+TL PC P C+ P SLL
Sbjct: 40 HGSTLRPCKCPLCRRPISLL 59



Score = 21.2 bits (43), Expect(2) = 7.6
Identities = 6/26 (23%), Positives = 11/26 (42%)
Frame = -2

Query: 332 GHHKPTISTENNTWSLPRCLLSSWKH 255
GH + + W C++ W+H
Sbjct: 15 GHFNAPCQSNCSHWFCGNCIMLVWRH 40


>tr|Q0WWX8|Q0WWX8_ARATH Putative uncharacterized protein At1g22510
OS=Arabidopsis thaliana GN=At1g22510 PE=2 SV=1
Length = 185

Score = 30.8 bits (68), Expect(2) = 7.6
Identities = 12/20 (60%), Positives = 14/20 (70%)
Frame = -3

Query: 265 HGNTLAPCLSPPCKEPSSLL 206
HG+TL PC P C+ P SLL
Sbjct: 40 HGSTLRPCKCPLCRRPISLL 59



Score = 21.2 bits (43), Expect(2) = 7.6
Identities = 6/26 (23%), Positives = 11/26 (42%)
Frame = -2

Query: 332 GHHKPTISTENNTWSLPRCLLSSWKH 255
GH + + W C++ W+H
Sbjct: 15 GHFNAPCQSNCSHWFCGNCIMLVWRH 40