BP912966
Clone id YMU001_000024_H04
Library
Length 560
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000024_H04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACTCACCCGTGCCAGCCGAGCTCAACACCCTCTGTAACATCAAGTCCACGGCTACCCTGG
CCTCCTGTAATGGTACATCTGCTCCAGCTCCTGCTCCTGCTCTTACTGATAAAAATGGGG
CTTACCCACCACAAAATATATGTATTTTGTAAGTCATCTTCATAGGGCTTGCATTGCTGT
TTTTAAATTTCAACTAGGCTCTAAGGTCGGTGCTTCAGATCACGAGGCGTTATTTGAGAG
TTGCAAGTCTACAAAAGGGCTGTGATCCCTGACGAATGCTATGAATAAGTCTGAACAACT
CAGAAAACTTGTACTATGACATGCACCATCATAATTTCAAAGTCTTCAAATGGGATCTCT
AACACCTCTCTCATTTCAAAGAGATCTCTACAATAGATGACATAAGCCTATCAGGCTGGT
ATCTCTACAGAACCCTCTCTCTCTCTCCCTCTCTTTCTCTCTCTCTCTCTCAGCCCACAA
ATATCTTCTTGCTTGGCATAGGTGTAGGCTATTAACATAGCCTTGATTGTGGCTGTCAAT
GAATGCTCCAACTATATATT
■■Homology search results ■■ -
sp_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912966|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_H04.
(560 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done

***** No hits found ******


tr_hit_id A1KC26
Definition tr|A1KC26|A1KC26_AZOSB Putative uncharacterized protein OS=Azoarcus sp. (strain BH72)
Align length 46
Score (bit) 33.9
E-value 6.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912966|Adiantum capillus-veneris mRNA, clone:
YMU001_000024_H04.
(560 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A1KC26|A1KC26_AZOSB Putative uncharacterized protein OS=Azoar... 34 6.2

>tr|A1KC26|A1KC26_AZOSB Putative uncharacterized protein OS=Azoarcus
sp. (strain BH72) GN=azo3766 PE=4 SV=1
Length = 429

Score = 33.9 bits (76), Expect = 6.2
Identities = 20/46 (43%), Positives = 26/46 (56%)
Frame = -2

Query: 142 HIFCGG*APFLSVRAGAGAGADVPLQEARVAVDLMLQRVLSSAGTG 5
H GG + ++ A AG D PL+ ARVA DL++ VL AG G
Sbjct: 94 HFEAGGVDRWAALAARAGLD-DTPLERARVAFDLVIPSVLLDAGAG 138