BP912983
Clone id YMU001_000025_A10
Library
Length 506
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000025_A10.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTCAGGTTAAAACATTTATAAGAGAAGAATTTTAGGTTTGCTGTGCTGCTATCAAATGA
AGAAAAGCCAAAAATTATTCCCTGCTAGAGAGCTAAGGCTTCCAGTCATGTCTTCTCTTC
CCTCAGTTTACACACATTTCTTCCCTTAGGGCATTGGAGCATTTCCAAAGCTCTTGATTA
CCCAACACAAAAAGGCCTGTTAGGCAAAGCATCTGGCTATGATTTGGAGTCTCCAAAAAA
TTTGAAGACTTGTGCTCTTTGATAAGCTAACTCACATGCCTAGACCAACAATCCTGTTAA
CATACACAAATTGCAGAGGAGAAATGATGCATTTGCCCTATCTCCAAACTTGACCTTTCA
CATCGCGCTCAAATACCTAGACTTCTGGCTCCAAACCAAAAAACATTACTATCTTCAATA
CACAACCCATATGAGCTCTACCGGAAAACCATTGTTATTTGGGTAAAGCATACAAGCACC
AAAGCTTCCCAGCCCAGCAGGTACTC
■■Homology search results ■■ -
sp_hit_id Q9CID5
Definition sp|Q9CID5|TREPP_LACLA Trehalose 6-phosphate phosphorylase OS=Lactococcus lactis subsp. lactis
Align length 38
Score (bit) 30.8
E-value 3.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912983|Adiantum capillus-veneris mRNA, clone:
YMU001_000025_A10.
(506 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9CID5|TREPP_LACLA Trehalose 6-phosphate phosphorylase OS=Lac... 31 3.8
sp|Q750Y3|DCN1_ASHGO Defective in cullin neddylation protein 1 O... 31 3.8
sp|Q6PB15|MFS11_XENLA UNC93-like protein MFSD11 OS=Xenopus laevi... 30 8.4

>sp|Q9CID5|TREPP_LACLA Trehalose 6-phosphate phosphorylase
OS=Lactococcus lactis subsp. lactis GN=trePP PE=1 SV=3
Length = 769

Score = 30.8 bits (68), Expect = 3.8
Identities = 13/38 (34%), Positives = 21/38 (55%)
Frame = +2

Query: 350 LTFHIALKYLDFWLQTKKHYYLQYTTHMSSTGKPLLFG 463
L +A + + WL+ + YYL T H S+T +P+ G
Sbjct: 608 LVKQLAYELPENWLKVNRDYYLARTVHGSTTSRPVFAG 645


>sp|Q750Y3|DCN1_ASHGO Defective in cullin neddylation protein 1
OS=Ashbya gossypii GN=DCN1 PE=3 SV=1
Length = 256

Score = 30.8 bits (68), Expect = 3.8
Identities = 16/39 (41%), Positives = 22/39 (56%), Gaps = 1/39 (2%)
Frame = +2

Query: 116 SSLSLHTFLPLGHWSISKAL-DYPTQKGLLGKASGYDLE 229
+S + T+L HWS+ AL D+ TQ G G+A Y E
Sbjct: 21 TSAAAETYLERNHWSLDHALDDFYTQSGGGGRAEQYSAE 59


>sp|Q6PB15|MFS11_XENLA UNC93-like protein MFSD11 OS=Xenopus laevis
GN=mfsd11 PE=2 SV=1
Length = 445

Score = 29.6 bits (65), Expect = 8.4
Identities = 14/34 (41%), Positives = 19/34 (55%)
Frame = -1

Query: 479 VLVCFTQITMVFR*SSYGLCIEDSNVFWFGARSL 378
+LV +T + + F YG CI NVF A+SL
Sbjct: 244 ILVAYTGLELTFYSGVYGTCIGSMNVFGTDAKSL 277


tr_hit_id B0WCR3
Definition tr|B0WCR3|B0WCR3_CULQU Phosphatidylserine receptor OS=Culex quinquefasciatus
Align length 46
Score (bit) 33.1
E-value 7.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP912983|Adiantum capillus-veneris mRNA, clone:
YMU001_000025_A10.
(506 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B0WCR3|B0WCR3_CULQU Phosphatidylserine receptor OS=Culex quin... 33 7.8

>tr|B0WCR3|B0WCR3_CULQU Phosphatidylserine receptor OS=Culex
quinquefasciatus GN=CpipJ_CPIJ004848 PE=4 SV=1
Length = 305

Score = 33.1 bits (74), Expect = 7.8
Identities = 16/46 (34%), Positives = 25/46 (54%)
Frame = +1

Query: 340 ISKLDLSHRAQIPRLLAPNQKTLLSSIHNPYELYRKTIVIWVKHTS 477
I DLS+ R L PN+ +LSS+ + +E +R+ W+ H S
Sbjct: 29 IPSADLSYEQFFARYLLPNKAVILSSVADSWECFRR----WINHDS 70